[{"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-06 00:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-06 00:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 00:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-06 00:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-06 00:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-06 00:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97742"}, "ts": "2023-07-06 00:00:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 00:00:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62012"}, "ts": "2023-07-06 00:00:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62012", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 00:00:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N5J2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:01:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N5J2.283.283"}, "ts": "2023-07-06 00:01:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94855"}, "ts": "2023-07-06 00:01:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C4J0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:01:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C4J0"}, "ts": "2023-07-06 00:01:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6IEE7.761.761"}, "ts": "2023-07-06 00:01:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IEE7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:01:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07195"}, "ts": "2023-07-06 00:01:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 00:01:58 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G99034SV"}, "ts": "2023-07-06 00:01:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G99034SV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 00:01:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16221681", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:02:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16221681", "type": "PubMed"}, "ts": "2023-07-06 00:02:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q3UHH1.53.53"}, "ts": "2023-07-06 00:02:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UHH1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:02:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78330"}, "ts": "2023-07-06 00:02:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULC0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:03:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9ULC0.64.64"}, "ts": "2023-07-06 00:03:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11171", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:03:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11171.104.104"}, "ts": "2023-07-06 00:03:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11047", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:03:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11047.21.21"}, "ts": "2023-07-06 00:03:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23434"}, "ts": "2023-07-06 00:03:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15207266", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:04:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15207266", "type": "PubMed"}, "ts": "2023-07-06 00:04:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91YK0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 00:04:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91YK0"}, "ts": "2023-07-06 00:04:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14954"}, "ts": "2023-07-06 00:05:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14954", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:05:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04921-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:05:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04921-1"}, "ts": "2023-07-06 00:05:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24385", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 00:05:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24385"}, "ts": "2023-07-06 00:05:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41271-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:06:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P49312.192.192"}, "ts": "2023-07-06 00:06:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49312", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:06:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99856", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:06:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99856.25.25"}, "ts": "2023-07-06 00:06:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:06:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96AD5.119.119"}, "ts": "2023-07-06 00:06:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AD5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:06:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q566Q9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:06:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q566Q9-1"}, "ts": "2023-07-06 00:06:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96LR9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:06:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96LR9.251.251"}, "ts": "2023-07-06 00:06:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18032602", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:07:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18032602", "type": "PubMed"}, "ts": "2023-07-06 00:07:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19436110", "type": "PubMed"}, "ts": "2023-07-06 00:07:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19436110", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:07:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39023-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:07:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P39023-1"}, "ts": "2023-07-06 00:07:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6IM78"}, "ts": "2023-07-06 00:07:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IM78", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:07:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07724-1"}, "ts": "2023-07-06 00:07:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07724-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:07:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92569", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:08:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92569"}, "ts": "2023-07-06 00:08:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G48414YA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 00:08:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49335", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:08:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P49335.180.180"}, "ts": "2023-07-06 00:08:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAU5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 00:09:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HAU5"}, "ts": "2023-07-06 00:09:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6W3E5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:09:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7892279", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:09:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7892279", "type": "PubMed"}, "ts": "2023-07-06 00:09:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BWG4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:09:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BWG4"}, "ts": "2023-07-06 00:09:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BUJ2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:09:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BUJ2.746.746"}, "ts": "2023-07-06 00:09:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BFQ4"}, "ts": "2023-07-06 00:10:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BFQ4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:10:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92673.14.14"}, "ts": "2023-07-06 00:10:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92673", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:10:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JJW1-1"}, "ts": "2023-07-06 00:10:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JJW1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:11:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H112.100.100"}, "ts": "2023-07-06 00:11:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H112", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:11:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 00:11:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G79211JZ"}, "ts": "2023-07-06 00:11:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G79211JZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 00:11:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13798.596.596"}, "ts": "2023-07-06 00:11:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13798", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:11:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17030985", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:12:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17030985", "type": "PubMed"}, "ts": "2023-07-06 00:12:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P46531.440.440"}, "ts": "2023-07-06 00:12:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46531", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:12:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31341297", "type": "PubMed"}, "ts": "2023-07-06 00:12:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31341297", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:12:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P83917"}, "ts": "2023-07-06 00:12:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13611.1237.1237"}, "ts": "2023-07-06 00:13:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13611", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:13:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48449-1"}, "ts": "2023-07-06 00:13:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48449-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:13:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P39880"}, "ts": "2023-07-06 00:13:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPG1"}, "ts": "2023-07-06 00:13:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPG1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:13:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63810-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:13:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63810-1"}, "ts": "2023-07-06 00:13:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:13:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4D7"}, "ts": "2023-07-06 00:13:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4D7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:13:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00519", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:13:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P00519.70.70"}, "ts": "2023-07-06 00:13:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JHD1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:14:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JHD1"}, "ts": "2023-07-06 00:14:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96N22.114.114"}, "ts": "2023-07-06 00:14:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96N22", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:14:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O55192", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:14:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O55192"}, "ts": "2023-07-06 00:14:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24553140", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:14:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24553140", "type": "PubMed"}, "ts": "2023-07-06 00:14:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGG7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:14:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGG7.24.24"}, "ts": "2023-07-06 00:14:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17086176", "type": "PubMed"}, "ts": "2023-07-06 00:15:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17086176", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:15:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGX3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:15:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGX3"}, "ts": "2023-07-06 00:15:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UNA0.468.468"}, "ts": "2023-07-06 00:16:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UNA0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:16:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97742", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:16:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96DB9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:16:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96DB9-1"}, "ts": "2023-07-06 00:16:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86TI0.235.235"}, "ts": "2023-07-06 00:16:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TI0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:16:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9WVM1.204.204"}, "ts": "2023-07-06 00:16:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60769"}, "ts": "2023-07-06 00:16:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WVM1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:16:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94855", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:17:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZDG4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:17:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZDG4-1"}, "ts": "2023-07-06 00:17:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07195", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:17:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80YE7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:17:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80YE7-1"}, "ts": "2023-07-06 00:17:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35590", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:17:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35590"}, "ts": "2023-07-06 00:17:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UF33", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:17:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UF33"}, "ts": "2023-07-06 00:17:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16525121", "type": "PubMed"}, "ts": "2023-07-06 00:17:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16525121", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:17:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02447", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:17:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q02447.563.563"}, "ts": "2023-07-06 00:17:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11796715", "type": "PubMed"}, "ts": "2023-07-06 00:18:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11796715", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:18:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16570", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:18:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16570"}, "ts": "2023-07-06 00:18:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14980.571.571"}, "ts": "2023-07-06 00:18:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14980", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:18:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q02817.25.25"}, "ts": "2023-07-06 00:18:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02817", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:18:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:18:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q52LR7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:18:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q52LR7"}, "ts": "2023-07-06 00:18:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23434", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:19:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60502"}, "ts": "2023-07-06 00:19:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DAN8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:19:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DAN8"}, "ts": "2023-07-06 00:19:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13421.496.496"}, "ts": "2023-07-06 00:19:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13421", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:19:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EPH0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:20:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:20:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EPH0"}, "ts": "2023-07-06 00:20:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56192", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:20:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56192"}, "ts": "2023-07-06 00:20:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14756.256.256"}, "ts": "2023-07-06 00:21:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14756", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:21:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10742173", "type": "PubMed"}, "ts": "2023-07-06 00:21:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10742173", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:21:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6W3E5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:22:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6W3E5"}, "ts": "2023-07-06 00:22:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19824718", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:23:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:23:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19824718", "type": "PubMed"}, "ts": "2023-07-06 00:23:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 00:23:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 00:23:31 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 00:23:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06247RL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 00:23:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06247RL"}, "ts": "2023-07-06 00:23:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06028.42.42"}, "ts": "2023-07-06 00:25:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06028", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:25:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14686"}, "ts": "2023-07-06 00:25:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:25:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "26214021"}, "ts": "2023-07-06 00:25:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 00:25:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02656"}, "ts": "2023-07-06 00:25:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:25:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02656", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:25:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-06 00:26:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01614ZM"}, "ts": "2023-07-06 00:26:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17015OC"}, "ts": "2023-07-06 00:26:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68008QO"}, "ts": "2023-07-06 00:26:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74722FL"}, "ts": "2023-07-06 00:26:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81006GJ"}, "ts": "2023-07-06 00:26:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29931IJ"}, "ts": "2023-07-06 00:26:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65562ZE"}, "ts": "2023-07-06 00:26:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-06 00:26:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFT6"}, "ts": "2023-07-06 00:26:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFT6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:26:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VIJ6"}, "ts": "2023-07-06 00:26:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VIJ6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 00:26:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01588-1"}, "ts": "2023-07-06 00:26:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75128-1"}, "ts": "2023-07-06 00:26:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75128-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:26:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G69032VE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 00:26:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G69032VE"}, "ts": "2023-07-06 00:27:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15822", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:27:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15822.1612.1612"}, "ts": "2023-07-06 00:27:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18428"}, "ts": "2023-07-06 00:27:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:27:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7L8W6"}, "ts": "2023-07-06 00:27:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L8W6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:27:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01008", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:27:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01008.68.68"}, "ts": "2023-07-06 00:27:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:27:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15262985", "type": "PubMed"}, "ts": "2023-07-06 00:27:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15262985", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:27:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TRW1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 00:28:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TRW1"}, "ts": "2023-07-06 00:28:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95714", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:28:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95714.1198.1198"}, "ts": "2023-07-06 00:28:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05412"}, "ts": "2023-07-06 00:28:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05412", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:28:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NUG4"}, "ts": "2023-07-06 00:28:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUG4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:28:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39880", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:29:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31540669", "type": "PubMed"}, "ts": "2023-07-06 00:29:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31540669", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:29:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5I0E8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:29:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5I0E8-1"}, "ts": "2023-07-06 00:29:50 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P57678", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 00:30:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57678", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 00:30:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14119.220.220"}, "ts": "2023-07-06 00:30:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14119", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:30:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33810963", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:30:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33810963", "type": "PubMed"}, "ts": "2023-07-06 00:30:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8530402", "type": "PubMed"}, "ts": "2023-07-06 00:30:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8530402", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:30:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q71DI3"}, "ts": "2023-07-06 00:30:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q71DI3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:30:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12738865", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:31:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12738865", "type": "PubMed"}, "ts": "2023-07-06 00:31:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4QR76", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:31:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4QR76"}, "ts": "2023-07-06 00:31:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24386", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:31:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24386"}, "ts": "2023-07-06 00:31:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60502", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:31:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H252", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:32:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H252"}, "ts": "2023-07-06 00:32:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10636893", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:32:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10636893", "type": "PubMed"}, "ts": "2023-07-06 00:32:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:33:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55097-1"}, "ts": "2023-07-06 00:33:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55097-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:33:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q497A9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:33:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q497A9-1"}, "ts": "2023-07-06 00:33:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G21071II", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 00:34:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G21071II"}, "ts": "2023-07-06 00:34:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:34:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8MTJ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:34:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A8MTJ3"}, "ts": "2023-07-06 00:34:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:35:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H756"}, "ts": "2023-07-06 00:35:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H756", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:35:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00653-1"}, "ts": "2023-07-06 00:36:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96AP7.344.344"}, "ts": "2023-07-06 00:36:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AP7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:36:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54920"}, "ts": "2023-07-06 00:36:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54920", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:36:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00629"}, "ts": "2023-07-06 00:36:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92692", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:36:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92692"}, "ts": "2023-07-06 00:36:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23097", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 00:36:37 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P23097", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 00:36:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 00:36:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G91649BT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 00:36:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G91649BT"}, "ts": "2023-07-06 00:36:43 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8IW35-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 00:36:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IW35-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 00:36:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99871"}, "ts": "2023-07-06 00:36:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99871", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:36:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34592197", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:37:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34592197", "type": "PubMed"}, "ts": "2023-07-06 00:37:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P28653.48.48"}, "ts": "2023-07-06 00:37:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A0W7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:37:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A0W7-1"}, "ts": "2023-07-06 00:37:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28653", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:37:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15309-1"}, "ts": "2023-07-06 00:37:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15309-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:37:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99983", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:37:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99983"}, "ts": "2023-07-06 00:37:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A3N5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 00:37:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A3N5"}, "ts": "2023-07-06 00:37:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYV7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:37:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:37:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYV7"}, "ts": "2023-07-06 00:37:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14CX5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 00:38:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14CX5"}, "ts": "2023-07-06 00:38:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15514", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:38:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15514"}, "ts": "2023-07-06 00:38:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48634"}, "ts": "2023-07-06 00:38:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48634", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:38:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2496302", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:38:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2496302", "type": "PubMed"}, "ts": "2023-07-06 00:38:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14866", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:38:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14866"}, "ts": "2023-07-06 00:38:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96B96", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:39:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96B96"}, "ts": "2023-07-06 00:39:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:39:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34019948", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:39:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34019948", "type": "PubMed"}, "ts": "2023-07-06 00:39:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80YC5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:39:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80YC5"}, "ts": "2023-07-06 00:39:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99ME3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:39:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99ME3"}, "ts": "2023-07-06 00:39:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NR46"}, "ts": "2023-07-06 00:40:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NR46", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:40:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15095872", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:40:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15095872", "type": "PubMed"}, "ts": "2023-07-06 00:40:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-06 00:40:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08754"}, "ts": "2023-07-06 00:40:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55010", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:40:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55010"}, "ts": "2023-07-06 00:40:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08754", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:40:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:40:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34725712", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:40:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34725712", "type": "PubMed"}, "ts": "2023-07-06 00:40:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96IZ0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:40:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96IZ0"}, "ts": "2023-07-06 00:40:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14686", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:41:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47196"}, "ts": "2023-07-06 00:41:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10092"}, "ts": "2023-07-06 00:41:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10092", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:41:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33214551", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:41:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:41:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33214551", "type": "PubMed"}, "ts": "2023-07-06 00:41:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G72735IY"}, "ts": "2023-07-06 00:42:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0U3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:42:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0U3"}, "ts": "2023-07-06 00:42:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43246", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:42:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43246"}, "ts": "2023-07-06 00:42:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06737"}, "ts": "2023-07-06 00:42:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:42:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35254053", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:42:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "35254053", "type": "PubMed"}, "ts": "2023-07-06 00:42:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01588-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:42:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18428", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:43:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:43:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06734", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:43:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06734.248.248"}, "ts": "2023-07-06 00:43:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UIB8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:43:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UIB8"}, "ts": "2023-07-06 00:43:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BUN8"}, "ts": "2023-07-06 00:43:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BUN8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 00:43:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 00:43:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08246", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 00:43:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08246"}, "ts": "2023-07-06 00:43:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZZ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:44:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZZ5"}, "ts": "2023-07-06 00:44:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75787-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:44:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75787-1"}, "ts": "2023-07-06 00:44:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95229", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 00:45:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95229"}, "ts": "2023-07-06 00:45:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7929268", "type": "PubMed"}, "ts": "2023-07-06 00:45:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7929268", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:45:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02652", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:46:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02652"}, "ts": "2023-07-06 00:46:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00526", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:47:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00526.66.66"}, "ts": "2023-07-06 00:47:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKL2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:47:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UKL2.148.148"}, "ts": "2023-07-06 00:47:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDV2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:47:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDV2"}, "ts": "2023-07-06 00:47:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62266"}, "ts": "2023-07-06 00:47:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75390"}, "ts": "2023-07-06 00:47:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 00:48:40 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 00:48:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 00:48:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7M6Y5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 00:48:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7M6Y5"}, "ts": "2023-07-06 00:48:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:48:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP61"}, "ts": "2023-07-06 00:48:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP61", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:48:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:49:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28799", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:49:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28799"}, "ts": "2023-07-06 00:49:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "super-search", "message": "page access"}, "ts": "2023-07-06 00:49:04 EDT-0400"}, {"api": "/supersearch/init/", "req": {}, "ts": "2023-07-06 00:49:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "super-search", "message": "page access"}, "ts": "2023-07-06 00:49:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "201845", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:49:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "201845", "type": "PubMed"}, "ts": "2023-07-06 00:49:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31685JQ"}, "ts": "2023-07-06 00:49:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63628AV"}, "ts": "2023-07-06 00:49:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-06 00:49:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08670"}, "ts": "2023-07-06 00:49:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UL59", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:50:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UL59"}, "ts": "2023-07-06 00:50:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q32P44", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:50:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14209"}, "ts": "2023-07-06 00:50:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q32P44"}, "ts": "2023-07-06 00:50:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRB3"}, "ts": "2023-07-06 00:50:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRB3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:50:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-06 00:50:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZGJ3"}, "ts": "2023-07-06 00:50:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZGJ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:51:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17174", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:51:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17174"}, "ts": "2023-07-06 00:51:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YB8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:51:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86YB8.30.30"}, "ts": "2023-07-06 00:51:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLF7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:51:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLF7"}, "ts": "2023-07-06 00:51:19 EDT-0400"}, {"api": "/supersearch/search/", "req": {"concept_query_list": [{"concept": "glycan", "query": {"aggregator": "$and", "unaggregated_list": [{"order": 0, "path": "glytoucan_ac", "operator": "$eq", "string_value": "G17689DH"}], "aggregated_list": []}}]}, "ts": "2023-07-06 00:51:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96IK1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:51:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96IK1-1"}, "ts": "2023-07-06 00:51:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "super-search", "message": "Performing Super Search. Super Search query={\"concept_query_list\":[{\"concept\":\"glycan\",\"query\":{\"aggregator\":\"$and\",\"unaggregated_list\":[{\"order\":0,\"path\":\"glytoucan_ac\",\"operator\":\"$eq\",\"string_value\":\"G17689DH\"}],\"aggregated_list\":[]}}]}"}, "ts": "2023-07-06 00:51:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">4f35fcabd680620a0ea2039f9e90cdf0", "user": "Anonymous", "type": "user", "page": "super-search", "message": "Super Search glycan list page. query={\"concept_query_list\":[{\"concept\":\"glycan\",\"query\":{\"aggregator\":\"$and\",\"unaggregated_list\":[{\"order\":0,\"path\":\"glytoucan_ac\",\"operator\":\"$eq\",\"string_value\":\"G17689DH\"}],\"aggregated_list\":[]}}]}"}, "ts": "2023-07-06 00:51:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4f35fcabd680620a0ea2039f9e90cdf0", "user": "Anonymous", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 00:51:42 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "4f35fcabd680620a0ea2039f9e90cdf0", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 00:51:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 00:51:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "super-search", "message": "page access"}, "ts": "2023-07-06 00:51:46 EDT-0400"}, {"api": "/supersearch/init/", "req": {}, "ts": "2023-07-06 00:51:47 EDT-0400"}, {"api": "/supersearch/list/", "req": {"id": "4f35fcabd680620a0ea2039f9e90cdf0", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 00:51:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14618"}, "ts": "2023-07-06 00:51:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4f35fcabd680620a0ea2039f9e90cdf0", "user": "Anonymous", "type": "user", "page": "super-search", "message": "Super Search modification initiated"}, "ts": "2023-07-06 00:51:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00653-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:51:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16784888", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:52:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16784888", "type": "PubMed"}, "ts": "2023-07-06 00:52:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7K6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:52:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z7K6"}, "ts": "2023-07-06 00:52:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P996", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:52:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60994-1"}, "ts": "2023-07-06 00:52:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60994-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:52:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00629", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:52:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G12398HZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 00:52:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 00:52:53 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 00:52:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 00:52:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 00:52:56 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 00:52:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61624-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:52:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61624-1"}, "ts": "2023-07-06 00:52:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Structure Search query={\"jobtype\":\"structure_search\",\"parameters\":{\"seq\":\"RES\\n1b:b-dglc-HEX-1:5\\n2s:n-acetyl\\n3b:b-dgal-HEX-1:5\\nLIN\\n1:1d(2 1)2n\\n2:1o(3 1)3d\",\"align\":\"wholeglycan\"}}"}, "ts": "2023-07-06 00:53:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6M1.488.488"}, "ts": "2023-07-06 00:53:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6M1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:53:04 EDT-0400"}, {"api": "/job/addnew/", "req": {"query": {"jobtype": "structure_search", "parameters": {"seq": "RES\n1b:b-dglc-HEX-1:5\n2s:n-acetyl\n3b:b-dgal-HEX-1:5\nLIN\n1:1d(2+1)2n\n2:1o(3+1)3d", "align": "wholeglycan"}}}, "ts": "2023-07-06 00:53:04 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 2}, "ts": "2023-07-06 00:53:07 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 2}, "ts": "2023-07-06 00:53:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">2", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Structure Search query=2 undefined undefined"}, "ts": "2023-07-06 00:53:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35fafddbf6f7236695aef8d2ede36087", "user": "Anonymous", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 00:53:08 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "35fafddbf6f7236695aef8d2ede36087", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 00:53:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00056MO"}, "ts": "2023-07-06 00:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13066OA"}, "ts": "2023-07-06 00:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59594LT"}, "ts": "2023-07-06 00:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04616ST"}, "ts": "2023-07-06 00:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96642XC"}, "ts": "2023-07-06 00:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70269KW"}, "ts": "2023-07-06 00:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36196GO"}, "ts": "2023-07-06 00:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47428UI"}, "ts": "2023-07-06 00:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80981NI"}, "ts": "2023-07-06 00:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53739JK"}, "ts": "2023-07-06 00:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95378PO"}, "ts": "2023-07-06 00:53:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73711GZ"}, "ts": "2023-07-06 00:53:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97947KM"}, "ts": "2023-07-06 00:53:12 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 00:53:12 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "35fafddbf6f7236695aef8d2ede36087", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 00:53:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 00:53:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35fafddbf6f7236695aef8d2ede36087", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-06 00:53:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 00:53:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17689DH", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 00:53:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 00:53:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42039FI"}, "ts": "2023-07-06 00:53:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000034"}, "ts": "2023-07-06 00:53:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-06 00:53:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83385WA"}, "ts": "2023-07-06 00:53:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69616RY"}, "ts": "2023-07-06 00:53:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35795"}, "ts": "2023-07-06 00:53:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35795", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 00:54:00 EDT-0400"}, {"api": "/job/addnew/", "req": {"query": {"jobtype": "structure_search", "parameters": {"seq": "RES\n1b:b-dglc-HEX-1:5\n2s:n-acetyl\n3b:b-dglc-HEX-1:5\n4s:n-acetyl\n5b:b-dman-HEX-1:5\n6b:a-dman-HEX-1:5\n7b:b-dglc-HEX-1:5\n8s:n-acetyl\n9b:b-dgal-HEX-1:5\n10b:a-dgro-dgal-NON-2:6|1:a|2:keto|3:d\n11s:n-acetyl\n12b:a-dman-HEX-1:5\n13b:b-dglc-HEX-1:5\n14s:n-acetyl\n15b:b-dgal-HEX-1:5\n16b:a-dgro-dgal-NON-2:6|1:a|2:keto|3:d\n17s:n-acetyl\n18b:a-lgal-HEX-1:5|6:d\nLIN\n1:1d(2+1)2n\n2:1o(4+1)3d\n3:3d(2+1)4n\n4:3o(4+1)5d\n5:5o(3+1)6d\n6:6o(2+1)7d\n7:7d(2+1)8n\n8:7o(4+1)9d\n9:9o(3+2)10d\n10:10d(5+1)11n\n11:5o(6+1)12d\n12:12o(2+1)13d\n13:13d(2+1)14n\n14:13o(4+1)15d\n15:15o(3+2)16d\n16:16d(5+1)17n\n17:1o(6+1)18d", "align": "wholeglycan"}}}, "ts": "2023-07-06 00:54:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G62182OO"}, "ts": "2023-07-06 00:54:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G62182OO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 00:54:05 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 3}, "ts": "2023-07-06 00:54:05 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 3}, "ts": "2023-07-06 00:54:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35fafddbf6f7236695aef8d2ede36087>3", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Structure Search query=3 undefined undefined"}, "ts": "2023-07-06 00:54:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6936e1e8a16960cc41976ef5f0d3ca9e", "user": "Anonymous", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 00:54:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35fafddbf6f7236695aef8d2ede36087", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Structure Search query={\"jobtype\":\"structure_search\",\"parameters\":{\"seq\":\"RES\\n1b:b-dglc-HEX-1:5\\n2s:n-acetyl\\n3b:b-dglc-HEX-1:5\\n4s:n-acetyl\\n5b:b-dman-HEX-1:5\\n6b:a-dman-HEX-1:5\\n7b:b-dglc-HEX-1:5\\n8s:n-acetyl\\n9b:b-dgal-HEX-1:5\\n10b:a-dgro-dgal-NON-2:6|1:a|2:keto|3:d\\n11s:n-acetyl\\n12b:a-dman-HEX-1:5\\n13b:b-dglc-HEX-1:5\\n14s:n-acetyl\\n15b:b-dgal-HEX-1:5\\n16b:a-dgro-dgal-NON-2:6|1:a|2:keto|3:d\\n17s:n-acetyl\\n18b:a-lgal-HEX-1:5|6:d\\nLIN\\n1:1d(2 1)2n\\n2:1o(4 1)3d\\n3:3d(2 1)4n\\n4:3o(4 1)5d\\n5:5o(3 1)6d\\n6:6o(2 1)7d\\n7:7d(2 1)8n\\n8:7o(4 1)9d\\n9:9o(3 2)10d\\n10:10d(5 1)11n\\n11:5o(6 1)12d\\n12:12o(2 1)13d\\n13:13d(2 1)14n\\n14:13o(4 1)15d\\n15:15o(3 2)16d\\n16:16d(5 1)17n\\n17:1o(6 1)18d\",\"align\":\"wholeglycan\"}}"}, "ts": "2023-07-06 00:54:06 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6936e1e8a16960cc41976ef5f0d3ca9e", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 00:54:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08146BT"}, "ts": "2023-07-06 00:54:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81459MV"}, "ts": "2023-07-06 00:54:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29255IL"}, "ts": "2023-07-06 00:54:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93822DY"}, "ts": "2023-07-06 00:54:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37626XQ"}, "ts": "2023-07-06 00:54:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86750HK"}, "ts": "2023-07-06 00:54:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64132UH"}, "ts": "2023-07-06 00:54:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24005JZ"}, "ts": "2023-07-06 00:54:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08606CV"}, "ts": "2023-07-06 00:54:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67393WG"}, "ts": "2023-07-06 00:54:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72956NR"}, "ts": "2023-07-06 00:54:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30048DT"}, "ts": "2023-07-06 00:54:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90889KG"}, "ts": "2023-07-06 00:54:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92180XB"}, "ts": "2023-07-06 00:54:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55818EE"}, "ts": "2023-07-06 00:54:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93720QH"}, "ts": "2023-07-06 00:54:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35242IF"}, "ts": "2023-07-06 00:54:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85511WQ"}, "ts": "2023-07-06 00:54:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86881ZW"}, "ts": "2023-07-06 00:54:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 00:54:11 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 00:54:11 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6936e1e8a16960cc41976ef5f0d3ca9e", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 00:54:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6936e1e8a16960cc41976ef5f0d3ca9e", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-06 00:54:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6936e1e8a16960cc41976ef5f0d3ca9e", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Substructure Search query={\"jobtype\":\"structure_search\",\"parameters\":{\"seq\":\"RES\\n1b:b-dglc-HEX-1:5\\n2s:n-acetyl\\n3b:b-dglc-HEX-1:5\\n4s:n-acetyl\\n5b:b-dman-HEX-1:5\\n6b:a-dman-HEX-1:5\\n7b:b-dglc-HEX-1:5\\n8s:n-acetyl\\n9b:b-dgal-HEX-1:5\\n10b:a-dgro-dgal-NON-2:6|1:a|2:keto|3:d\\n11s:n-acetyl\\n12b:a-dman-HEX-1:5\\n13b:b-dglc-HEX-1:5\\n14s:n-acetyl\\n15b:b-dgal-HEX-1:5\\n16b:a-dgro-dgal-NON-2:6|1:a|2:keto|3:d\\n17s:n-acetyl\\n18b:a-lgal-HEX-1:5|6:d\\nLIN\\n1:1d(2 1)2n\\n2:1o(4 1)3d\\n3:3d(2 1)4n\\n4:3o(4 1)5d\\n5:5o(3 1)6d\\n6:6o(2 1)7d\\n7:7d(2 1)8n\\n8:7o(4 1)9d\\n9:9o(3 2)10d\\n10:10d(5 1)11n\\n11:5o(6 1)12d\\n12:12o(2 1)13d\\n13:13d(2 1)14n\\n14:13o(4 1)15d\\n15:15o(3 2)16d\\n16:16d(5 1)17n\\n17:1o(6 1)18d\",\"align\":\"substructure\"}}"}, "ts": "2023-07-06 00:54:24 EDT-0400"}, {"api": "/job/addnew/", "req": {"query": {"jobtype": "structure_search", "parameters": {"seq": "RES\n1b:b-dglc-HEX-1:5\n2s:n-acetyl\n3b:b-dglc-HEX-1:5\n4s:n-acetyl\n5b:b-dman-HEX-1:5\n6b:a-dman-HEX-1:5\n7b:b-dglc-HEX-1:5\n8s:n-acetyl\n9b:b-dgal-HEX-1:5\n10b:a-dgro-dgal-NON-2:6|1:a|2:keto|3:d\n11s:n-acetyl\n12b:a-dman-HEX-1:5\n13b:b-dglc-HEX-1:5\n14s:n-acetyl\n15b:b-dgal-HEX-1:5\n16b:a-dgro-dgal-NON-2:6|1:a|2:keto|3:d\n17s:n-acetyl\n18b:a-lgal-HEX-1:5|6:d\nLIN\n1:1d(2+1)2n\n2:1o(4+1)3d\n3:3d(2+1)4n\n4:3o(4+1)5d\n5:5o(3+1)6d\n6:6o(2+1)7d\n7:7d(2+1)8n\n8:7o(4+1)9d\n9:9o(3+2)10d\n10:10d(5+1)11n\n11:5o(6+1)12d\n12:12o(2+1)13d\n13:13d(2+1)14n\n14:13o(4+1)15d\n15:15o(3+2)16d\n16:16d(5+1)17n\n17:1o(6+1)18d", "align": "substructure"}}}, "ts": "2023-07-06 00:54:24 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 4}, "ts": "2023-07-06 00:54:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "error", "page": "glycan-search", "message": "No results. Substructure Search query=4 Structure is too big"}, "ts": "2023-07-06 00:54:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RK0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:54:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-06 00:54:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P70288.424.424"}, "ts": "2023-07-06 00:54:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70288", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:54:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12714604", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:54:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12714604", "type": "PubMed"}, "ts": "2023-07-06 00:54:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8262053", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:54:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8262053", "type": "PubMed"}, "ts": "2023-07-06 00:54:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52789"}, "ts": "2023-07-06 00:54:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G12341GU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 00:54:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G12341GU"}, "ts": "2023-07-06 00:54:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31072445", "type": "PubMed"}, "ts": "2023-07-06 00:54:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31072445", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:54:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UM22"}, "ts": "2023-07-06 00:55:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UM22", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:55:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:56:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36894"}, "ts": "2023-07-06 00:56:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36894", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:56:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6936e1e8a16960cc41976ef5f0d3ca9e", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Substructure Search query={\"jobtype\":\"structure_search\",\"parameters\":{\"seq\":\"RES\\n1b:b-dglc-HEX-1:5\\n2s:n-acetyl\\n3b:b-dglc-HEX-1:5\\n4s:n-acetyl\\n5b:b-dman-HEX-1:5\\n6b:a-dman-HEX-1:5\\n7b:b-dglc-HEX-1:5\\n8s:n-acetyl\\n9b:b-dgal-HEX-1:5\\n10b:a-dgro-dgal-NON-2:6|1:a|2:keto|3:d\\n11s:n-acetyl\\n12b:a-dman-HEX-1:5\\n13b:b-dglc-HEX-1:5\\n14s:n-acetyl\\n15b:b-dgal-HEX-1:5\\n16b:a-dgro-dgal-NON-2:6|1:a|2:keto|3:d\\n17s:n-acetyl\\n18b:a-lgal-HEX-1:5|6:d\\nLIN\\n1:1d(2 1)2n\\n2:1o(4 1)3d\\n3:3d(2 1)4n\\n4:3o(4 1)5d\\n5:5o(3 1)6d\\n6:6o(2 1)7d\\n7:7d(2 1)8n\\n8:7o(4 1)9d\\n9:9o(3 2)10d\\n10:10d(5 1)11n\\n11:5o(6 1)12d\\n12:12o(2 1)13d\\n13:13d(2 1)14n\\n14:13o(4 1)15d\\n15:15o(3 2)16d\\n16:16d(5 1)17n\\n17:1o(6 1)18d\",\"align\":\"substructure\"}}"}, "ts": "2023-07-06 00:56:04 EDT-0400"}, {"api": "/job/addnew/", "req": {"query": {"jobtype": "structure_search", "parameters": {"seq": "RES\n1b:b-dglc-HEX-1:5\n2s:n-acetyl\n3b:b-dglc-HEX-1:5\n4s:n-acetyl\n5b:b-dman-HEX-1:5\n6b:a-dman-HEX-1:5\n7b:b-dglc-HEX-1:5\n8s:n-acetyl\n9b:b-dgal-HEX-1:5\n10b:a-dgro-dgal-NON-2:6|1:a|2:keto|3:d\n11s:n-acetyl\n12b:a-dman-HEX-1:5\n13b:b-dglc-HEX-1:5\n14s:n-acetyl\n15b:b-dgal-HEX-1:5\n16b:a-dgro-dgal-NON-2:6|1:a|2:keto|3:d\n17s:n-acetyl\n18b:a-lgal-HEX-1:5|6:d\nLIN\n1:1d(2+1)2n\n2:1o(4+1)3d\n3:3d(2+1)4n\n4:3o(4+1)5d\n5:5o(3+1)6d\n6:6o(2+1)7d\n7:7d(2+1)8n\n8:7o(4+1)9d\n9:9o(3+2)10d\n10:10d(5+1)11n\n11:5o(6+1)12d\n12:12o(2+1)13d\n13:13d(2+1)14n\n14:13o(4+1)15d\n15:15o(3+2)16d\n16:16d(5+1)17n\n17:1o(6+1)18d", "align": "substructure"}}}, "ts": "2023-07-06 00:56:04 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 5}, "ts": "2023-07-06 00:56:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "error", "page": "glycan-search", "message": "No results. Substructure Search query=5 Structure is too big"}, "ts": "2023-07-06 00:56:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88900", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:56:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88900"}, "ts": "2023-07-06 00:56:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "site-search", "message": "page access"}, "ts": "2023-07-06 00:56:20 EDT-0400"}, {"api": "/site/search_init/", "req": {}, "ts": "2023-07-06 00:56:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49368", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:56:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49368"}, "ts": "2023-07-06 00:56:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20702", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:56:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P20702.63.63"}, "ts": "2023-07-06 00:56:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T160", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:56:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T160"}, "ts": "2023-07-06 00:56:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "site-search", "message": "Performing Site Search"}, "ts": "2023-07-06 00:56:44 EDT-0400"}, {"api": "/supersearch/search/", "req": {"concept_query_list": [{"concept": "site", "query": {"aggregator": "$and", "unaggregated_list": [{"path": "site_seq", "order": 0, "operator": "$eq", "string_value": "S"}, {"path": "neighbors.categories", "order": 1, "operator": "$eq", "string_value": "glycosylation_flag"}, {"path": "neighbors.distance", "order": 2, "operator": "$lte", "numeric_value": 3}, {"path": "glycosylation_flag", "order": 3, "operator": "$eq", "string_value": "true"}], "aggregated_list": []}}]}, "ts": "2023-07-06 00:56:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">701aa501e7f42dd4fa57002efeb843fe", "user": "Anonymous", "type": "user", "page": "site-search", "message": "Site Search query={\"proteinId\":[],\"aminoType\":\"S\",\"annotations\":[\"glycosylation_flag\"],\"annotationOperation\":\"$and\",\"singleannotations\":\"glycosylation_flag\",\"operator\":\"$lte\",\"updownoperator\":\"down_seq\",\"distance\":3,\"combinedPattern\":\"\"}"}, "ts": "2023-07-06 00:56:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "site-list", "message": "page access"}, "ts": "2023-07-06 00:56:55 EDT-0400"}, {"api": "/supersearch/list/", "req": {"id": "701aa501e7f42dd4fa57002efeb843fe", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 00:56:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "701aa501e7f42dd4fa57002efeb843fe", "user": "Anonymous", "type": "user", "page": "site-list", "message": "page access"}, "ts": "2023-07-06 00:56:56 EDT-0400"}, {"api": "/site/search_init/", "req": {}, "ts": "2023-07-06 00:56:56 EDT-0400"}, {"api": "/supersearch/list/", "req": {"id": "701aa501e7f42dd4fa57002efeb843fe", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 00:56:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "site-search", "message": "page access"}, "ts": "2023-07-06 00:57:07 EDT-0400"}, {"api": "/site/search_init/", "req": {}, "ts": "2023-07-06 00:57:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05783-1"}, "ts": "2023-07-06 00:57:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05783-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:57:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:57:12 EDT-0400"}, {"api": "/supersearch/list/", "req": {"id": "701aa501e7f42dd4fa57002efeb843fe", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 00:57:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NBI5"}, "ts": "2023-07-06 00:57:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NBI5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:57:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "701aa501e7f42dd4fa57002efeb843fe", "user": "Anonymous", "type": "user", "page": "site-search", "message": "Search modification initiated"}, "ts": "2023-07-06 00:57:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-06 00:57:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 00:57:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47012YE"}, "ts": "2023-07-06 00:57:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-06 00:57:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NI28", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:57:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NI28"}, "ts": "2023-07-06 00:57:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:57:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02656", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:57:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02656"}, "ts": "2023-07-06 00:57:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G72735IY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 00:58:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16828VN"}, "ts": "2023-07-06 00:58:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13938SZ"}, "ts": "2023-07-06 00:58:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72735IY"}, "ts": "2023-07-06 00:58:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19790PJ"}, "ts": "2023-07-06 00:58:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27313UE"}, "ts": "2023-07-06 00:58:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24657IT"}, "ts": "2023-07-06 00:58:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30514JJ"}, "ts": "2023-07-06 00:58:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46312FW"}, "ts": "2023-07-06 00:58:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50380XT"}, "ts": "2023-07-06 00:58:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54685SU"}, "ts": "2023-07-06 00:58:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58167CQ"}, "ts": "2023-07-06 00:58:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51677AC"}, "ts": "2023-07-06 00:58:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67269NB"}, "ts": "2023-07-06 00:58:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71470CO"}, "ts": "2023-07-06 00:58:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98671GW"}, "ts": "2023-07-06 00:58:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28361969", "type": "PubMed"}, "ts": "2023-07-06 00:58:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28361969", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:58:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28361969", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 00:58:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 00:58:19 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 00:58:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 00:58:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06737", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:58:25 EDT-0400"}, {"api": "/job/init/", "req": {}, "ts": "2023-07-06 00:58:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-06 00:58:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-06 00:58:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q811B5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 00:58:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q811B5-1"}, "ts": "2023-07-06 00:58:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "blast", "message": "Performing Blast Search.Blast Search query={\"jobtype\":\"blastp\",\"parameters\":{\"seq\":\"MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNMEDLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS\",\"targetdb\":\"canonicalsequences_all\",\"evalue\":0.001,\"num_alignments\":250}}"}, "ts": "2023-07-06 00:58:34 EDT-0400"}, {"api": "/job/addnew/", "req": {"query": {"jobtype": "blastp", "parameters": {"seq": "MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNMEDLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS", "targetdb": "canonicalsequences_all", "evalue": 0.001, "num_alignments": 250}}}, "ts": "2023-07-06 00:58:34 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 6}, "ts": "2023-07-06 00:58:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">6", "user": "Anonymous", "type": "user", "page": "blast", "message": "Blast Search query=6"}, "ts": "2023-07-06 00:58:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6", "user": "Anonymous", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-06 00:58:37 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 6}, "ts": "2023-07-06 00:58:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6", "user": "Anonymous", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: P14210-1, Q08048-1, P17945-1, P26927-1, P26928-1, F7FMS0-1, P20918-1, Q01177-1, Q2TV78-1, P00747-1, P08519-1, P19637-1, P11214-1, P00750-1, P00734-1, P19221-1, Q9R098-1, F7ELL4-1, P18292-1, Q04756-1, Q6L711-1, Q80YC5-1, Q8K0D2-1, P29598-1, D3ZTE0-1, Q14520-1, P00748-1, P06869-1, Q9ESD1-1, Q9ES87-1, Q02844-1, P00749-1, P20231-1, Q15661-1, P97435-1, P27435-1, Q16651-1, Q8NF86-1, P98073-1, Q9CR35-1, Q8CGR6-1, Q8K1T0-1, D3ZY65-1, Q3UKY7-1, D4ACZ0-1, D3ZJ70-1, A0A8I6APH4-1, E9Q409-1, Q792Z0-1, P14272-1, Q9UKR3-1, P03952-1, D4A911-1, P26262-1, W4VSR6-1, P07477-1, P07338-1, P05981-1, Q92876-1, Q9R0T7-1, Q9QUK9-1, F1LVG1-1, P00763-1, Q80UR4-1, Q8BJR6-1, Q9BQR3-1, Q91Y47-1, Q9Z1R9-1, A0A8I5Y5M6-1, Q792Y8-1, P08217-1, P57727-1, A0A8I6AAZ3-1, A0A8I5ZME9-1, O60235-1, P21845-1, Q8IQ10-1, P50343-1, Q792Y9-1, D3ZQV0-1, P00762-1, Q5U405-1, O35453-1, P17538-1, P08426-1, F7FMG3-1, M0RAL3-1, Q6GPI1-1, Q9CPN9-1, P05208-1, Q6BEA2-1, Q9UNI1-1, P12788-1, P00774-1, P35030-1, A0A0G2K4I9-1, Q9BYE2-1, P00773-1, Q792Z1-1, P15947-1, A0A1W2Q644-1, P08218-1, G3V8H1-1, P32821-1, P36373-1, P07146-1, Q9NRS4-1, Q7Z410-1, A1L453-1, A0A0N4SVQ0-1, Q16609-1, O15393-1, F6R7E8-1, Q9CPN7-1, Q9JHJ7-1, A0A8I6GHE1-1, Q7RTY9-1, D4AB49-1, F1LSP0-1, Q924N9-1, Q80WM7-1, Q05511-1, D3Z9X4-1, Q7RTY3-1, P00758-1, P03951-1, P69526-1, A0A8I6AMU8-1, Q8VCA5-1, P15948-1, P07478-1, Q8NHM4-1, P32822-1, P15946-1, Q6IE15-1, Q91X79-1, P00757-1, P83748-1, Q9ER04-1, Q14B25-1, P40313-1, Q9UBX7-2, Q8VHJ4-1, P09093-1, Q61754-1, Q9GZN4-1, A6H6T1-1, P08861-1, Q9Y6M0-1, Q61955-1, Q9CQ52-1, Q6P7D7-1, P49862-1, Q9QUL7-1, P00759-1, F1M2C8-1, Q9JIQ8-1, Q9VSU2-1, Q9NRR2-1, Q9ER05-1, P15945-1, P36374-1, M9NDV6-1, Q1JRP2-1, P69525-1, D3ZZK6-1, D4AAE4-1, P07288-1, Q8VHK8-1, P36375-1, M0R778-1, D4AEK6-1, Q8IRX5-1, A0A0G2KAN9-1, Q9JM71-1, P00756-1, P49864-1, Q61759-1, Q9VEA0-1, B5DF96-1, P36369-1, Q9H3S3-1, P06870-1, O35205-1, Q920S2-1, Q6UWB4-1, P36376-1, F1M091-1, O88780-1, P00746-1, Q402U7-1, D3ZXU4-1, P04071-1, Q99MS4-1, P33587-1, Q91VE3-1, Q9ER10-1, Q5K2P9-1, P15949-1, Q7RTY5-2, Q9DBI0-1, P07647-1, Q9QYN3-1, Q6AXZ6-1, O43240-1, Q8VIF2-1, P31394-1, O54854-1, F1M6D3-1, Q9QYZ9-1, P00755-1, Q8IU80-4, P36368-1, P29293-1, Q3V0Q7-1, A0A8I6G6J0-1, Q86WS5-1, Q32M27-1, Q7RTY7-1, Q5QSK2-1, A6NIE9-1, P08709-1, P04070-1, P07628-1, Q9P0G3-1, Q8CGR5-1, Q06605-1, P23578-1, Q03238-1, Q9H2R5-1, A0A8I6A055-1, Q6ZWK6-1, Q9Y5Y6-1, D4A488-1, G3V934-1, Q91Y82-1, P20151-1, Q5K4E3-1, O08643-1, P24158-1, F1M348-1, D4ABF2-1, Q86T26-1, Q5K2P8-1, Q8BZ10-1, Q8BIK6-1, O08762-1, Q9JJI7-1, Q9VGB9-1, Q9VUG2-1"}, "ts": "2023-07-06 00:59:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18486321", "type": "PubMed"}, "ts": "2023-07-06 00:59:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18486321", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 00:59:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5H9F3.1243.1243"}, "ts": "2023-07-06 00:59:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5H9F3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 00:59:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z127", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:00:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z127"}, "ts": "2023-07-06 01:00:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-06 01:00:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6", "user": "Anonymous", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-06 01:00:02 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 6}, "ts": "2023-07-06 01:00:02 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-06 01:00:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZDS3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:00:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZDS3-1"}, "ts": "2023-07-06 01:00:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16150-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 01:00:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 01:00:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16150-1"}, "ts": "2023-07-06 01:00:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9065197", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 01:00:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9065197", "type": "PubMed"}, "ts": "2023-07-06 01:00:19 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-06 01:00:20 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 6}, "ts": "2023-07-06 01:00:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56593", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 01:00:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56593"}, "ts": "2023-07-06 01:00:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 01:00:28 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-06 01:00:28 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-06 01:00:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-06 01:00:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q924Y8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:00:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q924Y8-1"}, "ts": "2023-07-06 01:00:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6", "user": "Anonymous", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: P14210-1, Q08048-1, P17945-1, P26927-1, P26928-1, F7FMS0-1, P20918-1, Q01177-1, Q2TV78-1, P00747-1, P08519-1, P19637-1, P11214-1, P00750-1, P00734-1, P19221-1, Q9R098-1, F7ELL4-1, P18292-1, Q04756-1, Q6L711-1, Q80YC5-1, Q8K0D2-1, P29598-1, D3ZTE0-1, Q14520-1, P00748-1, P06869-1, Q9ESD1-1, Q9ES87-1, Q02844-1, P00749-1, P20231-1, Q15661-1, P97435-1, P27435-1, Q16651-1, Q8NF86-1, P98073-1, Q9CR35-1, Q8CGR6-1, Q8K1T0-1, D3ZY65-1, Q3UKY7-1, D4ACZ0-1, D3ZJ70-1, A0A8I6APH4-1, E9Q409-1, Q792Z0-1, P14272-1, Q9UKR3-1, P03952-1, D4A911-1, P26262-1, W4VSR6-1, P07477-1, P07338-1, P05981-1, Q92876-1, Q9R0T7-1, Q9QUK9-1, F1LVG1-1, P00763-1, Q80UR4-1, Q8BJR6-1, Q9BQR3-1, Q91Y47-1, Q9Z1R9-1, A0A8I5Y5M6-1, Q792Y8-1, P08217-1, P57727-1, A0A8I6AAZ3-1, A0A8I5ZME9-1, O60235-1, P21845-1, Q8IQ10-1, P50343-1, Q792Y9-1, D3ZQV0-1, P00762-1, Q5U405-1, O35453-1, P17538-1, P08426-1, F7FMG3-1, M0RAL3-1, Q6GPI1-1, Q9CPN9-1, P05208-1, Q6BEA2-1, Q9UNI1-1, P12788-1, P00774-1, P35030-1, A0A0G2K4I9-1, Q9BYE2-1, P00773-1, Q792Z1-1, P15947-1, A0A1W2Q644-1, P08218-1, G3V8H1-1, P32821-1, P36373-1, P07146-1, Q9NRS4-1, Q7Z410-1, A1L453-1, A0A0N4SVQ0-1, Q16609-1, O15393-1, F6R7E8-1, Q9CPN7-1, Q9JHJ7-1, A0A8I6GHE1-1, Q7RTY9-1, D4AB49-1, F1LSP0-1, Q924N9-1, Q80WM7-1, Q05511-1, D3Z9X4-1, Q7RTY3-1, P00758-1, P03951-1, P69526-1, A0A8I6AMU8-1, Q8VCA5-1, P15948-1, P07478-1, Q8NHM4-1, P32822-1, P15946-1, Q6IE15-1, Q91X79-1, P00757-1, P83748-1, Q9ER04-1, Q14B25-1, P40313-1, Q9UBX7-2, Q8VHJ4-1, P09093-1, Q61754-1, Q9GZN4-1, A6H6T1-1, P08861-1, Q9Y6M0-1, Q61955-1, Q9CQ52-1, Q6P7D7-1, P49862-1, Q9QUL7-1, P00759-1, F1M2C8-1, Q9JIQ8-1, Q9VSU2-1, Q9NRR2-1, Q9ER05-1, P15945-1, P36374-1, M9NDV6-1, Q1JRP2-1, P69525-1, D3ZZK6-1, D4AAE4-1, P07288-1, Q8VHK8-1, P36375-1, M0R778-1, D4AEK6-1, Q8IRX5-1, A0A0G2KAN9-1, Q9JM71-1, P00756-1, P49864-1, Q61759-1, Q9VEA0-1, B5DF96-1, P36369-1, Q9H3S3-1, P06870-1, O35205-1, Q920S2-1, Q6UWB4-1, P36376-1, F1M091-1, O88780-1, P00746-1, Q402U7-1, D3ZXU4-1, P04071-1, Q99MS4-1, P33587-1, Q91VE3-1, Q9ER10-1, Q5K2P9-1, P15949-1, Q7RTY5-2, Q9DBI0-1, P07647-1, Q9QYN3-1, Q6AXZ6-1, O43240-1, Q8VIF2-1, P31394-1, O54854-1, F1M6D3-1, Q9QYZ9-1, P00755-1, Q8IU80-4, P36368-1, P29293-1, Q3V0Q7-1, A0A8I6G6J0-1, Q86WS5-1, Q32M27-1, Q7RTY7-1, Q5QSK2-1, A6NIE9-1, P08709-1, P04070-1, P07628-1, Q9P0G3-1, Q8CGR5-1, Q06605-1, P23578-1, Q03238-1, Q9H2R5-1, A0A8I6A055-1, Q6ZWK6-1, Q9Y5Y6-1, D4A488-1, G3V934-1, Q91Y82-1, P20151-1, Q5K4E3-1, O08643-1, P24158-1, F1M348-1, D4ABF2-1, Q86T26-1, Q5K2P8-1, Q8BZ10-1, Q8BIK6-1, O08762-1, Q9JJI7-1, Q9VGB9-1, Q9VUG2-1"}, "ts": "2023-07-06 01:00:40 EDT-0400"}, {"api": "/job/init/", "req": {}, "ts": "2023-07-06 01:01:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-06 01:01:25 EDT-0400"}, {"api": "/job/detail/", "req": {"jobid": 6}, "ts": "2023-07-06 01:01:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6", "user": "Anonymous", "type": "user", "page": "blast", "message": "Blast search modification initiated"}, "ts": "2023-07-06 01:01:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQE7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:01:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQE7"}, "ts": "2023-07-06 01:01:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 01:01:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBM1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 01:01:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HBM1"}, "ts": "2023-07-06 01:01:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6", "user": "Anonymous", "type": "user", "page": "blast", "message": "Performing Blast Search.Blast Search query={\"jobtype\":\"blastp\",\"parameters\":{\"seq\":\"MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCAN\",\"targetdb\":\"canonicalsequences_all\",\"evalue\":0.001,\"num_alignments\":250}}"}, "ts": "2023-07-06 01:01:37 EDT-0400"}, {"api": "/job/addnew/", "req": {"query": {"jobtype": "blastp", "parameters": {"seq": "MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCAN", "targetdb": "canonicalsequences_all", "evalue": 0.001, "num_alignments": 250}}}, "ts": "2023-07-06 01:01:37 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 7}, "ts": "2023-07-06 01:01:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6>7", "user": "Anonymous", "type": "user", "page": "blast", "message": "Blast Search query=7"}, "ts": "2023-07-06 01:01:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7", "user": "Anonymous", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-06 01:01:41 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 7}, "ts": "2023-07-06 01:01:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7", "user": "Anonymous", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: P14210-1, Q08048-1, P17945-1"}, "ts": "2023-07-06 01:01:47 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 7}, "ts": "2023-07-06 01:01:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 01:02:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G99991IU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 01:02:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G99991IU"}, "ts": "2023-07-06 01:02:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5FW60-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:02:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5FW60-1"}, "ts": "2023-07-06 01:02:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NHC7"}, "ts": "2023-07-06 01:03:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NHC7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:03:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58753", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 01:03:07 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P58753", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 01:03:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13557-1.171.171"}, "ts": "2023-07-06 01:03:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13557-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 01:03:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJU3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:03:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJU3"}, "ts": "2023-07-06 01:03:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QWT9-1"}, "ts": "2023-07-06 01:03:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98073"}, "ts": "2023-07-06 01:03:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12970", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:03:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12970"}, "ts": "2023-07-06 01:03:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HAN9-1"}, "ts": "2023-07-06 01:03:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAN9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:03:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62266", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:03:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75390", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:03:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05279MG"}, "ts": "2023-07-06 01:04:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGK6"}, "ts": "2023-07-06 01:04:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGK6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 01:04:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2T7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 01:04:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2T7"}, "ts": "2023-07-06 01:04:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55157"}, "ts": "2023-07-06 01:04:23 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-06 01:04:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-06 01:04:25 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 01:04:25 EDT-0400"}, {"api": "/typeahead/typeahead/", "req": {"field": "glytoucan_ac", "value": "G17689DH", "limit": 100}, "ts": "2023-07-06 01:04:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "quick-search", "message": "Performing Quick Search"}, "ts": "2023-07-06 01:04:33 EDT-0400"}, {"api": "/usecases/glycan_to_biosynthesis_enzymes/", "req": {"glytoucan_ac": "G17689DH", "tax_id": 9606}, "ts": "2023-07-06 01:04:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">2c73acfe5765766dab136735cbe55acc", "user": "Anonymous", "type": "user", "page": "quick-search", "message": "Quick Search Question_1 = /9606/G17689DH"}, "ts": "2023-07-06 01:04:34 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 01:04:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2c73acfe5765766dab136735cbe55acc", "user": "Anonymous", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 01:04:34 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "2c73acfe5765766dab136735cbe55acc", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 01:04:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-06 01:04:42 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-06 01:04:42 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "2c73acfe5765766dab136735cbe55acc", "offset": 1, "limit": 1, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 01:04:42 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 01:04:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-06 01:04:43 EDT-0400"}, {"api": "/typeahead/typeahead/", "req": {"field": "glytoucan_ac", "value": "G17689DH", "limit": 100}, "ts": "2023-07-06 01:04:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 01:04:50 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 01:04:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 01:04:59 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 01:04:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 01:05:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10435622", "type": "PubMed"}, "ts": "2023-07-06 01:05:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10435622", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 01:05:01 EDT-0400"}, {"api": "/typeahead/typeahead/", "req": {"field": "glytoucan_ac", "value": "G17689DH", "limit": 100}, "ts": "2023-07-06 01:05:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Performing Advanced Search"}, "ts": "2023-07-06 01:05:07 EDT-0400"}, {"api": "/glycan/search/", "req": {"operation": "AND", "query_type": "search_glycan", "glycan_name": "", "glycan_identifier": {"glycan_id": "G17689DH", "subsumption": "none"}}, "ts": "2023-07-06 01:05:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">d7a6549c87567e796d0d5c8905900c60", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"glycan_name\":\"\",\"glycan_identifier\":{\"glycan_id\":\"G17689DH\",\"subsumption\":\"none\"}}"}, "ts": "2023-07-06 01:05:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "d7a6549c87567e796d0d5c8905900c60", "user": "Anonymous", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 01:05:09 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "d7a6549c87567e796d0d5c8905900c60", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 01:05:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08670", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:05:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 01:05:31 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 01:05:31 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "d7a6549c87567e796d0d5c8905900c60", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 01:05:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "d7a6549c87567e796d0d5c8905900c60", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-06 01:05:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25751282", "type": "PubMed"}, "ts": "2023-07-06 01:05:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25751282", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 01:05:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-06 01:05:43 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 01:05:44 EDT-0400"}, {"api": "/typeahead/typeahead/", "req": {"field": "uniprot_canonical_ac", "value": "P14210", "limit": 100}, "ts": "2023-07-06 01:05:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6K5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:05:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "Performing Advanced Search"}, "ts": "2023-07-06 01:05:50 EDT-0400"}, {"api": "/protein/search/", "req": {"operation": "AND", "query_type": "search_protein", "uniprot_canonical_ac": "P14210"}, "ts": "2023-07-06 01:05:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">b6a8aba0f7e6026e70823875ab5373a9", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_protein\",\"uniprot_canonical_ac\":\"P14210\"}"}, "ts": "2023-07-06 01:05:52 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 01:05:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b6a8aba0f7e6026e70823875ab5373a9", "user": "Anonymous", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 01:05:52 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "b6a8aba0f7e6026e70823875ab5373a9", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 01:05:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210-1"}, "ts": "2023-07-06 01:05:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:06:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14209", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:06:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19059PI"}, "ts": "2023-07-06 01:06:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01543ZX"}, "ts": "2023-07-06 01:06:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-06 01:06:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-06 01:06:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-06 01:06:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52126RR"}, "ts": "2023-07-06 01:06:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-06 01:06:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57789QC"}, "ts": "2023-07-06 01:06:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60542VK"}, "ts": "2023-07-06 01:06:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64394MX"}, "ts": "2023-07-06 01:06:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74239ZQ"}, "ts": "2023-07-06 01:06:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77252PU"}, "ts": "2023-07-06 01:06:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89664KV"}, "ts": "2023-07-06 01:06:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93656SY"}, "ts": "2023-07-06 01:06:12 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 01:06:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b6a8aba0f7e6026e70823875ab5373a9", "user": "Anonymous", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 01:06:15 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "b6a8aba0f7e6026e70823875ab5373a9", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 01:06:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14896"}, "ts": "2023-07-06 01:06:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:06:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14896", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:06:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-06 01:06:18 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 01:06:19 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "b6a8aba0f7e6026e70823875ab5373a9", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 01:06:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b6a8aba0f7e6026e70823875ab5373a9", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "Search modification initiated"}, "ts": "2023-07-06 01:06:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 01:06:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 01:06:31 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 01:06:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NR22", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 01:06:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NR22.168.168"}, "ts": "2023-07-06 01:06:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z0H6-1"}, "ts": "2023-07-06 01:06:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z0H6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:06:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-06 01:06:57 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-06 01:06:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-06 01:06:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-06 01:07:14 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyConnect", "output_namespace": "GlyTouCan", "input_idlist": ["118", "114", "615", "641", "678"]}, "ts": "2023-07-06 01:07:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">61a2532804e5d36036008cddec060318", "user": "Anonymous", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyConnect\",\"output_namespace\":\"GlyTouCan\",\"input_idlist\":\"118,114,615,641,678\"}"}, "ts": "2023-07-06 01:07:15 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "61a2532804e5d36036008cddec060318", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-06 01:07:16 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "61a2532804e5d36036008cddec060318", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-06 01:07:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "61a2532804e5d36036008cddec060318", "user": "Anonymous", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-06 01:07:16 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "61a2532804e5d36036008cddec060318", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-06 01:07:16 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "61a2532804e5d36036008cddec060318", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-06 01:07:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "61a2532804e5d36036008cddec060318", "user": "Anonymous", "type": "user", "page": "mapper-result", "message": "csv"}, "ts": "2023-07-06 01:07:22 EDT-0400"}, {"api": "/data/list_download/", "req": {"id": "61a2532804e5d36036008cddec060318", "download_type": "idmapping_list_all", "format": "csv", "compressed": false}, "ts": "2023-07-06 01:07:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G75132WH", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 01:07:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G75132WH"}, "ts": "2023-07-06 01:07:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75132WH"}, "ts": "2023-07-06 01:07:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46935AJ"}, "ts": "2023-07-06 01:07:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20908", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 01:07:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P20908.424.424"}, "ts": "2023-07-06 01:07:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G75132WH", "user": "Anonymous", "type": "user", "page": "glycan", "message": "json"}, "ts": "2023-07-06 01:07:40 EDT-0400"}, {"api": "/data/detail_download/", "req": {"id": "G75132WH", "download_type": "glycan_detail", "format": "json", "compressed": false}, "ts": "2023-07-06 01:07:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14618", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:07:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G75132WH", "user": "Anonymous", "type": "user", "page": "glycan", "message": "csv"}, "ts": "2023-07-06 01:08:11 EDT-0400"}, {"api": "/data/section_download/", "req": {"id": "G75132WH", "download_type": "glycan_section", "section": "subsumption_descendant", "format": "csv", "compressed": false}, "ts": "2023-07-06 01:08:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G75132WH", "user": "Anonymous", "type": "user", "page": "glycan", "message": "csv"}, "ts": "2023-07-06 01:08:30 EDT-0400"}, {"api": "/data/section_download/", "req": {"id": "G75132WH", "download_type": "glycan_section", "section": "subsumption_descendant", "format": "csv", "compressed": true}, "ts": "2023-07-06 01:08:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R3P8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:09:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R3P8-1"}, "ts": "2023-07-06 01:09:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10425SO"}, "ts": "2023-07-06 01:09:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14585", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 01:10:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14585"}, "ts": "2023-07-06 01:10:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00912UN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 01:10:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52789", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:10:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLN9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:11:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60603"}, "ts": "2023-07-06 01:11:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60603", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:11:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UI36"}, "ts": "2023-07-06 01:11:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UI36", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:11:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VH51", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 01:11:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8VH51.136.136"}, "ts": "2023-07-06 01:11:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6Y1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:11:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:12:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q921W5"}, "ts": "2023-07-06 01:12:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q921W5", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:12:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42867-1"}, "ts": "2023-07-06 01:12:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42867-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:12:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99997WS"}, "ts": "2023-07-06 01:13:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99980WG"}, "ts": "2023-07-06 01:13:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99992LL"}, "ts": "2023-07-06 01:13:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99981ST"}, "ts": "2023-07-06 01:13:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99969SS"}, "ts": "2023-07-06 01:13:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99956MJ"}, "ts": "2023-07-06 01:13:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99954ZJ"}, "ts": "2023-07-06 01:13:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99954GW"}, "ts": "2023-07-06 01:13:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99952ON"}, "ts": "2023-07-06 01:13:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99950SF"}, "ts": "2023-07-06 01:13:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99943EE"}, "ts": "2023-07-06 01:13:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99935CU"}, "ts": "2023-07-06 01:13:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99927HL"}, "ts": "2023-07-06 01:13:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99897FQ"}, "ts": "2023-07-06 01:13:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99896CG"}, "ts": "2023-07-06 01:13:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99891PR"}, "ts": "2023-07-06 01:13:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99883ZA"}, "ts": "2023-07-06 01:13:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99876AH"}, "ts": "2023-07-06 01:13:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99873PN"}, "ts": "2023-07-06 01:13:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99866WK"}, "ts": "2023-07-06 01:13:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3T1I3"}, "ts": "2023-07-06 01:13:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3T1I3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:13:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CQ79"}, "ts": "2023-07-06 01:13:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CQ79", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:13:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40225"}, "ts": "2023-07-06 01:13:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:13:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42867-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:13:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42867-1"}, "ts": "2023-07-06 01:13:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "15009664"}, "ts": "2023-07-06 01:13:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8163463", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 01:14:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8163463", "type": "PubMed"}, "ts": "2023-07-06 01:14:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7KZN9"}, "ts": "2023-07-06 01:14:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7KZN9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:14:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0JPN0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:14:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0JPN0"}, "ts": "2023-07-06 01:14:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14151-1"}, "ts": "2023-07-06 01:14:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92890"}, "ts": "2023-07-06 01:14:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92890", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:14:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-06 01:14:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41732", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 01:14:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P41732.155.155"}, "ts": "2023-07-06 01:14:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11362"}, "ts": "2023-07-06 01:15:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41225", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:15:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41225"}, "ts": "2023-07-06 01:15:28 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 01:15:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 01:15:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 01:15:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TB40-1"}, "ts": "2023-07-06 01:15:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TB40-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:15:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 01:15:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17689DH", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 01:15:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 01:15:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:16:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02656", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:16:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02656"}, "ts": "2023-07-06 01:16:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-06 01:17:45 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 01:17:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-06 01:17:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03111"}, "ts": "2023-07-06 01:17:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03111", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:17:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 01:17:57 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "rbfox2", "term_category": "any"}, "ts": "2023-07-06 01:17:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">3d0a7070e354fa7845fe5d6380c098b9", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"rbfox2\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 01:17:57 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 01:17:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3d0a7070e354fa7845fe5d6380c098b9", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 01:17:57 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "3d0a7070e354fa7845fe5d6380c098b9", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 01:17:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43251-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:18:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43251-1"}, "ts": "2023-07-06 01:18:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 01:18:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23396"}, "ts": "2023-07-06 01:18:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G26939ZY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 01:18:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G26939ZY"}, "ts": "2023-07-06 01:18:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 01:18:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22028470", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 01:18:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22028470", "type": "PubMed"}, "ts": "2023-07-06 01:18:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43027", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:18:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43027"}, "ts": "2023-07-06 01:18:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98073", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:19:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19838-1"}, "ts": "2023-07-06 01:19:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05279MG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 01:20:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55157", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:20:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PXI5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:20:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9PXI5"}, "ts": "2023-07-06 01:20:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24836561", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 01:21:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20186120", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 01:21:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20186120", "type": "PubMed"}, "ts": "2023-07-06 01:21:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24836561", "type": "PubMed"}, "ts": "2023-07-06 01:21:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YZ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:21:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IU80", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:21:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IU80"}, "ts": "2023-07-06 01:21:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z4Q2-1"}, "ts": "2023-07-06 01:21:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08795", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:22:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08795"}, "ts": "2023-07-06 01:22:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14562.834.834"}, "ts": "2023-07-06 01:22:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14562", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 01:22:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13224"}, "ts": "2023-07-06 01:22:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12417987", "type": "PubMed"}, "ts": "2023-07-06 01:22:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12417987", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 01:22:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08722"}, "ts": "2023-07-06 01:22:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62824"}, "ts": "2023-07-06 01:23:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62824", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 01:23:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O55082"}, "ts": "2023-07-06 01:23:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O55082", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 01:23:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16442775", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 01:23:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16442775", "type": "PubMed"}, "ts": "2023-07-06 01:23:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80V53"}, "ts": "2023-07-06 01:24:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80V53", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:24:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AYG9"}, "ts": "2023-07-06 01:24:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AYG9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 01:24:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AYG9", "user": "Undecided", "type": "error", "page": "protVista", "message": "Network error. ProtVista Detail api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 01:24:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:25:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7RTM1"}, "ts": "2023-07-06 01:25:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJU3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:25:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJU3"}, "ts": "2023-07-06 01:25:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58753", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 01:25:29 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P58753", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 01:25:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G10425SO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 01:25:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07763", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 01:25:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q07763.206.206"}, "ts": "2023-07-06 01:25:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G71013KY"}, "ts": "2023-07-06 01:26:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91YJ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:26:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91YJ3"}, "ts": "2023-07-06 01:26:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TPF1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 01:26:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TPF1"}, "ts": "2023-07-06 01:26:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BJV7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 01:26:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BJV7"}, "ts": "2023-07-06 01:26:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WVS6"}, "ts": "2023-07-06 01:27:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WVS6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 01:27:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IY33"}, "ts": "2023-07-06 01:27:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IY33", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:27:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V785-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:28:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V785-1"}, "ts": "2023-07-06 01:28:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16445", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 01:28:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16445"}, "ts": "2023-07-06 01:28:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P82995-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:28:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P82995-1"}, "ts": "2023-07-06 01:28:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:28:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08842"}, "ts": "2023-07-06 01:28:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08842", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:28:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 01:28:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29262349", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 01:28:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29262349", "type": "PubMed"}, "ts": "2023-07-06 01:28:54 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 01:28:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 01:28:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 01:28:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07262RR"}, "ts": "2023-07-06 01:29:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07262RR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 01:29:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12259"}, "ts": "2023-07-06 01:29:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40225", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:29:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q60932.206.206"}, "ts": "2023-07-06 01:29:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60932", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 01:29:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-06 01:29:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-06 01:29:56 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-06 01:29:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q53TQ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:29:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q53TQ3"}, "ts": "2023-07-06 01:29:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14151-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:30:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04828", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 01:30:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04828"}, "ts": "2023-07-06 01:30:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11362", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:31:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 01:32:19 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 01:32:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 01:32:32 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 01:32:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 01:32:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Performing Composition Search"}, "ts": "2023-07-06 01:32:41 EDT-0400"}, {"api": "/glycan/search/", "req": {"composition": [{"residue": "dhex", "min": 0, "max": 0}, {"residue": "hex", "min": 3, "max": 3}, {"residue": "hexnac", "min": 2, "max": 2}, {"residue": "hexa", "min": 0, "max": 0}, {"residue": "hexn", "min": 0, "max": 0}, {"residue": "neuac", "min": 0, "max": 0}, {"residue": "neugc", "min": 0, "max": 0}, {"residue": "p", "min": 0, "max": 0}, {"residue": "pent", "min": 0, "max": 0}, {"residue": "s", "min": 0, "max": 0}, {"residue": "other", "min": 0, "max": 0}]}, "ts": "2023-07-06 01:32:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">20571b5cbf6a59225ec7c79f7151a9a4", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Composition Search query={\"composition\":[{\"residue\":\"dhex\",\"min\":0,\"max\":0},{\"residue\":\"hex\",\"min\":3,\"max\":3},{\"residue\":\"hexnac\",\"min\":2,\"max\":2},{\"residue\":\"hexa\",\"min\":0,\"max\":0},{\"residue\":\"hexn\",\"min\":0,\"max\":0},{\"residue\":\"neuac\",\"min\":0,\"max\":0},{\"residue\":\"neugc\",\"min\":0,\"max\":0},{\"residue\":\"p\",\"min\":0,\"max\":0},{\"residue\":\"pent\",\"min\":0,\"max\":0},{\"residue\":\"s\",\"min\":0,\"max\":0},{\"residue\":\"other\",\"min\":0,\"max\":0}]}"}, "ts": "2023-07-06 01:32:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20571b5cbf6a59225ec7c79f7151a9a4", "user": "Anonymous", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 01:32:48 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "20571b5cbf6a59225ec7c79f7151a9a4", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 01:32:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49848", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:32:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49848"}, "ts": "2023-07-06 01:32:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:32:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16594", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:32:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16594"}, "ts": "2023-07-06 01:32:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22768VO"}, "ts": "2023-07-06 01:32:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62167DK"}, "ts": "2023-07-06 01:32:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20624LQ"}, "ts": "2023-07-06 01:32:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85862JT"}, "ts": "2023-07-06 01:32:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25323VU"}, "ts": "2023-07-06 01:32:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:32:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 01:32:55 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 01:32:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19422693", "type": "PubMed"}, "ts": "2023-07-06 01:32:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19422693", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 01:32:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00026MO"}, "ts": "2023-07-06 01:32:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97547WF"}, "ts": "2023-07-06 01:32:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34027VM"}, "ts": "2023-07-06 01:32:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25413GH"}, "ts": "2023-07-06 01:32:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14669DU"}, "ts": "2023-07-06 01:32:56 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "20571b5cbf6a59225ec7c79f7151a9a4", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 01:32:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28681TP"}, "ts": "2023-07-06 01:32:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80062GG"}, "ts": "2023-07-06 01:32:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34749PQ"}, "ts": "2023-07-06 01:32:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43547MI"}, "ts": "2023-07-06 01:32:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70874WW"}, "ts": "2023-07-06 01:32:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96834JC"}, "ts": "2023-07-06 01:32:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10756ZZ"}, "ts": "2023-07-06 01:32:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51699SI"}, "ts": "2023-07-06 01:32:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47715OE"}, "ts": "2023-07-06 01:32:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39852CS"}, "ts": "2023-07-06 01:32:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20571b5cbf6a59225ec7c79f7151a9a4", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-06 01:32:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 01:32:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70994MS"}, "ts": "2023-07-06 01:32:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68402"}, "ts": "2023-07-06 01:33:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20571b5cbf6a59225ec7c79f7151a9a4", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 01:33:08 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "G17689DH", "term_category": "any"}, "ts": "2023-07-06 01:33:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20571b5cbf6a59225ec7c79f7151a9a4>6db0a535f896f31ad73eeecc521ee9e7", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"G17689DH\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 01:33:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6db0a535f896f31ad73eeecc521ee9e7", "user": "Anonymous", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 01:33:10 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6db0a535f896f31ad73eeecc521ee9e7", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 01:33:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48844XN"}, "ts": "2023-07-06 01:33:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94019IV"}, "ts": "2023-07-06 01:33:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74026TS"}, "ts": "2023-07-06 01:33:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61734US"}, "ts": "2023-07-06 01:33:13 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 01:33:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 01:33:16 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6db0a535f896f31ad73eeecc521ee9e7", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 01:33:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6db0a535f896f31ad73eeecc521ee9e7", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-06 01:33:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34846842", "type": "PubMed"}, "ts": "2023-07-06 01:34:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 01:34:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34846842", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 01:34:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33214551", "type": "PubMed"}, "ts": "2023-07-06 01:34:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 01:34:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33214551", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 01:34:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96LC7"}, "ts": "2023-07-06 01:34:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19838-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:35:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 01:35:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15942.182.182"}, "ts": "2023-07-06 01:35:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16594"}, "ts": "2023-07-06 01:35:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:35:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16594", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:35:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15942", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 01:35:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HB40"}, "ts": "2023-07-06 01:35:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HB40", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:36:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 01:36:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12370829", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 01:36:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12370829", "type": "PubMed"}, "ts": "2023-07-06 01:36:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08173"}, "ts": "2023-07-06 01:37:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15902306", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 01:37:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60894"}, "ts": "2023-07-06 01:37:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60894", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:37:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15902306", "type": "PubMed"}, "ts": "2023-07-06 01:37:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13224", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:38:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27191501", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 01:38:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27191501", "type": "PubMed"}, "ts": "2023-07-06 01:38:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27191501", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 01:38:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08722", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:38:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z5L9"}, "ts": "2023-07-06 01:39:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BND5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:40:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BND5"}, "ts": "2023-07-06 01:40:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:40:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62179-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:40:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62179-1"}, "ts": "2023-07-06 01:41:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70309", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:41:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70309"}, "ts": "2023-07-06 01:41:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18337459", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 01:41:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18337459", "type": "PubMed"}, "ts": "2023-07-06 01:41:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55347"}, "ts": "2023-07-06 01:41:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55347", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:41:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9039914", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 01:42:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9039914", "type": "PubMed"}, "ts": "2023-07-06 01:42:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:44:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q71M36"}, "ts": "2023-07-06 01:44:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q71M36", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:44:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29590"}, "ts": "2023-07-06 01:44:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29590", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:44:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12259", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:45:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16620.516.516"}, "ts": "2023-07-06 01:45:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16620", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 01:45:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q658P3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 01:46:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q658P3.256.256"}, "ts": "2023-07-06 01:46:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 01:46:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IW00", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 01:46:59 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8IW00", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 01:47:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5FW60-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:47:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5FW60-1"}, "ts": "2023-07-06 01:47:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NET6"}, "ts": "2023-07-06 01:47:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NET6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:47:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NW68", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:47:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NW68"}, "ts": "2023-07-06 01:47:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75352"}, "ts": "2023-07-06 01:47:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A0A075B6Q5-1.36.36"}, "ts": "2023-07-06 01:47:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A075B6Q5-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 01:47:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63ZY3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 01:48:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q63ZY3.344.344"}, "ts": "2023-07-06 01:48:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30082"}, "ts": "2023-07-06 01:48:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68402", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:49:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:49:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14697"}, "ts": "2023-07-06 01:49:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14697", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:49:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3T1J1"}, "ts": "2023-07-06 01:49:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3T1J1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 01:49:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 01:50:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P82987.165.165"}, "ts": "2023-07-06 01:50:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P82987", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 01:50:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y485.1101.1101"}, "ts": "2023-07-06 01:50:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y485", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 01:50:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11169"}, "ts": "2023-07-06 01:51:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11169", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:51:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFL0"}, "ts": "2023-07-06 01:51:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16656"}, "ts": "2023-07-06 01:51:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 01:51:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G37399XV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 01:51:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G37399XV"}, "ts": "2023-07-06 01:51:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01959"}, "ts": "2023-07-06 01:52:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z0H6"}, "ts": "2023-07-06 01:52:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z0H6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 01:52:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EQ20"}, "ts": "2023-07-06 01:52:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EQ20", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:52:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LNH2-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 01:52:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LNH2-1"}, "ts": "2023-07-06 01:52:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94956", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 01:53:11 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O94956", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 01:53:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08173", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:53:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80T32", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 01:53:42 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q80T32", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 01:53:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:53:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14137", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:53:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14137"}, "ts": "2023-07-06 01:53:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92686"}, "ts": "2023-07-06 01:54:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92686", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:54:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08195", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 01:54:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08195.134.134"}, "ts": "2023-07-06 01:54:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15465"}, "ts": "2023-07-06 01:55:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-06 01:55:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29577888", "type": "PubMed"}, "ts": "2023-07-06 01:55:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29577888", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 01:55:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WTS2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:55:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WTS2-1"}, "ts": "2023-07-06 01:55:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27816-1"}, "ts": "2023-07-06 01:56:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86SX6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 01:56:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86SX6"}, "ts": "2023-07-06 01:56:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29180572", "type": "PubMed"}, "ts": "2023-07-06 01:57:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29180572", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 01:57:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP60", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:57:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP60"}, "ts": "2023-07-06 01:57:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06995WZ"}, "ts": "2023-07-06 01:58:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06995WZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 01:58:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:58:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35908"}, "ts": "2023-07-06 01:58:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35908", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:58:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTW8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 01:58:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96ST3.601.601"}, "ts": "2023-07-06 01:59:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96ST3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 01:59:18 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-06 02:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-06 02:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 02:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-06 02:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-06 02:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-06 02:00:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000072"}, "ts": "2023-07-06 02:00:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P1W3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:00:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P1W3.543.543"}, "ts": "2023-07-06 02:00:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11388-1"}, "ts": "2023-07-06 02:01:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22681887", "type": "PubMed"}, "ts": "2023-07-06 02:01:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22681887", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:01:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HB21.9.9"}, "ts": "2023-07-06 02:02:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NCS4"}, "ts": "2023-07-06 02:02:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HB21", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:02:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NCS4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:02:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13190", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:02:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13190.79.79"}, "ts": "2023-07-06 02:02:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31785", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:02:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31785"}, "ts": "2023-07-06 02:02:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKR0"}, "ts": "2023-07-06 02:02:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKR0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:02:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DTC2-1"}, "ts": "2023-07-06 02:03:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DTC2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:03:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02223-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 02:03:29 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q02223-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 02:03:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18430724", "type": "PubMed"}, "ts": "2023-07-06 02:03:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18430724", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:03:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75352", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:03:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75387", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:04:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75387.76.76"}, "ts": "2023-07-06 02:04:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 02:04:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BY87"}, "ts": "2023-07-06 02:04:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BY87", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 02:04:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y237", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 02:04:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y237"}, "ts": "2023-07-06 02:04:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30082", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:04:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WVV5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:04:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WVV5.351.351"}, "ts": "2023-07-06 02:04:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68FL6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 02:04:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68FL6"}, "ts": "2023-07-06 02:04:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07392QY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 02:05:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15942"}, "ts": "2023-07-06 02:05:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00533-1"}, "ts": "2023-07-06 02:05:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q497M6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:06:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q497M6"}, "ts": "2023-07-06 02:06:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16656", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:07:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14141", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:07:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14141"}, "ts": "2023-07-06 02:07:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H228.115.115"}, "ts": "2023-07-06 02:07:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H228", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:07:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01959", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:08:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BXS4.229.229"}, "ts": "2023-07-06 02:09:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXS4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:09:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PL45", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:09:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08183"}, "ts": "2023-07-06 02:09:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6PL45.79.79"}, "ts": "2023-07-06 02:09:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08183", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:09:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZBN3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:09:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZBN3"}, "ts": "2023-07-06 02:09:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53004", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:09:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53004"}, "ts": "2023-07-06 02:09:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NHC8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:10:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NHC8.23.23"}, "ts": "2023-07-06 02:10:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G55220VL"}, "ts": "2023-07-06 02:10:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G55220VL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 02:10:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06226-1"}, "ts": "2023-07-06 02:10:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:10:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06226-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:10:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G22310AV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 02:11:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15465", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:11:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27816-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:11:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYB5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:13:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NYB5.481.481"}, "ts": "2023-07-06 02:13:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYG3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:13:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BYG3.223.223"}, "ts": "2023-07-06 02:13:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0CB42"}, "ts": "2023-07-06 02:13:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0CB42", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:13:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXI7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:13:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P53814.565.565"}, "ts": "2023-07-06 02:14:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53814", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:14:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35177", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:15:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35177"}, "ts": "2023-07-06 02:15:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WY54", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:16:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WY54"}, "ts": "2023-07-06 02:16:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75154", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:16:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75154.645.645"}, "ts": "2023-07-06 02:16:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15942", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:17:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11388-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:17:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P3W7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:18:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6P3W7.734.734"}, "ts": "2023-07-06 02:18:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NP61.77.77"}, "ts": "2023-07-06 02:19:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP61", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:19:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13094", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:20:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13094.113.113"}, "ts": "2023-07-06 02:20:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34662354", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:20:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34662354", "type": "PubMed"}, "ts": "2023-07-06 02:20:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34662354", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 02:20:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:20:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35610", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:20:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35610"}, "ts": "2023-07-06 02:20:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 02:21:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EQH3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:21:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:21:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9EQH3.791.791"}, "ts": "2023-07-06 02:21:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34725712", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:21:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34725712", "type": "PubMed"}, "ts": "2023-07-06 02:21:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28510447", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:21:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:21:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28510447", "type": "PubMed"}, "ts": "2023-07-06 02:21:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02751-15"}, "ts": "2023-07-06 02:21:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NWM8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:21:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NWM8"}, "ts": "2023-07-06 02:21:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00533-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:21:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:22:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28510447", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:22:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28510447", "type": "PubMed"}, "ts": "2023-07-06 02:22:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34190193", "type": "PubMed"}, "ts": "2023-07-06 02:22:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34190193", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:22:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07001", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:22:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34190193", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 02:22:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q07001.244.244"}, "ts": "2023-07-06 02:22:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99706", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:22:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:22:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99706"}, "ts": "2023-07-06 02:22:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99594"}, "ts": "2023-07-06 02:23:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99594", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:23:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:23:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35083852", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:23:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "35083852", "type": "PubMed"}, "ts": "2023-07-06 02:23:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:23:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35289036", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:23:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "35289036", "type": "PubMed"}, "ts": "2023-07-06 02:23:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:23:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:24:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31492838", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:24:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31492838", "type": "PubMed"}, "ts": "2023-07-06 02:24:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:24:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30059200", "type": "PubMed"}, "ts": "2023-07-06 02:24:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30059200", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:24:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRX2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 02:24:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRX2"}, "ts": "2023-07-06 02:24:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29237092", "type": "PubMed"}, "ts": "2023-07-06 02:24:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29237092", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:24:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:24:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:24:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23186163", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:24:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23186163", "type": "PubMed"}, "ts": "2023-07-06 02:24:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "35254053", "type": "PubMed"}, "ts": "2023-07-06 02:24:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:24:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35254053", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:24:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q76LX8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:25:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P84095"}, "ts": "2023-07-06 02:25:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P84095", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:25:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:25:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34670102", "type": "PubMed"}, "ts": "2023-07-06 02:25:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34670102", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:25:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86WN1"}, "ts": "2023-07-06 02:26:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86WN1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:26:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06756"}, "ts": "2023-07-06 02:26:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12540536", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:27:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12540536", "type": "PubMed"}, "ts": "2023-07-06 02:27:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 02:27:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WUY9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:27:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WUY9"}, "ts": "2023-07-06 02:27:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "35083852", "type": "PubMed"}, "ts": "2023-07-06 02:28:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35083852", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:28:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35610", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:28:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35610"}, "ts": "2023-07-06 02:28:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98073", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:29:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P98073.440.440"}, "ts": "2023-07-06 02:29:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28908", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:29:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28908"}, "ts": "2023-07-06 02:29:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:29:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14777"}, "ts": "2023-07-06 02:29:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14777", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:29:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULX7"}, "ts": "2023-07-06 02:29:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULX7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:29:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30550", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:29:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30550"}, "ts": "2023-07-06 02:29:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:29:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NNW7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:29:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NNW7"}, "ts": "2023-07-06 02:29:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31596", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:30:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P31596.24.24"}, "ts": "2023-07-06 02:30:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20786", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:30:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20786"}, "ts": "2023-07-06 02:30:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:30:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26178009", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:30:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26178009", "type": "PubMed"}, "ts": "2023-07-06 02:30:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G34585DT"}, "ts": "2023-07-06 02:31:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G34585DT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 02:31:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H7V2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 02:31:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H7V2"}, "ts": "2023-07-06 02:31:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95996", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:31:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95996"}, "ts": "2023-07-06 02:31:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 02:32:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 02:32:15 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 02:32:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75955", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:32:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75955"}, "ts": "2023-07-06 02:32:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66K64-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:33:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66K64-1"}, "ts": "2023-07-06 02:33:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IY81.335.335"}, "ts": "2023-07-06 02:33:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IY81", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:33:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPN6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:33:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UPN6"}, "ts": "2023-07-06 02:33:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16251899", "type": "PubMed"}, "ts": "2023-07-06 02:33:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16251899", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:33:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6M7.791.791"}, "ts": "2023-07-06 02:34:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6M7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:34:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:34:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04003"}, "ts": "2023-07-06 02:34:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04003", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:34:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28178239", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:34:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28178239", "type": "PubMed"}, "ts": "2023-07-06 02:34:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51671"}, "ts": "2023-07-06 02:34:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51671", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:34:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60855", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:35:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60855"}, "ts": "2023-07-06 02:35:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IXB1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 02:35:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IXB1"}, "ts": "2023-07-06 02:35:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23716601", "type": "PubMed"}, "ts": "2023-07-06 02:35:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23716601", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:35:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23716601", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 02:35:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:36:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41180", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:36:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P41180.387.387"}, "ts": "2023-07-06 02:36:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:36:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96FC7"}, "ts": "2023-07-06 02:36:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96FC7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:36:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02751-15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:37:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZS17"}, "ts": "2023-07-06 02:37:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZS17", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:37:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y487"}, "ts": "2023-07-06 02:37:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y487", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:38:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P2E7.273.273"}, "ts": "2023-07-06 02:38:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2E7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:38:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLC4"}, "ts": "2023-07-06 02:39:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z5L7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:40:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z5L7.370.370"}, "ts": "2023-07-06 02:40:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18904WZ"}, "ts": "2023-07-06 02:41:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18904WZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 02:41:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BY42", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:41:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BY42.25.25"}, "ts": "2023-07-06 02:41:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y210.860.860"}, "ts": "2023-07-06 02:41:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y210", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:41:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JV73"}, "ts": "2023-07-06 02:41:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JV73", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:41:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:41:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37913", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 02:42:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37913"}, "ts": "2023-07-06 02:42:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06756", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:42:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48664", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:43:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P48664.36.36"}, "ts": "2023-07-06 02:43:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66X03", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:43:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66X03"}, "ts": "2023-07-06 02:43:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q495T6.705.705"}, "ts": "2023-07-06 02:43:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q495T6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:43:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28562"}, "ts": "2023-07-06 02:44:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28562", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 02:44:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00749"}, "ts": "2023-07-06 02:45:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15375", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:45:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15375.796.796"}, "ts": "2023-07-06 02:45:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00160", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:45:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00160.193.193"}, "ts": "2023-07-06 02:45:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BV10", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:46:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BV10"}, "ts": "2023-07-06 02:46:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62799"}, "ts": "2023-07-06 02:46:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62799", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 02:46:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VHJ5-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 02:47:12 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8VHJ5-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 02:47:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9GZK6.6.6"}, "ts": "2023-07-06 02:47:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZK6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:47:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q008S8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:48:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q008S8-1"}, "ts": "2023-07-06 02:48:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UVY6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:48:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UVY6.62.62"}, "ts": "2023-07-06 02:48:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F6ZF91-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:48:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F6ZF91-1"}, "ts": "2023-07-06 02:48:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13190", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:49:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13190"}, "ts": "2023-07-06 02:49:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "S4R1W5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:50:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "S4R1W5"}, "ts": "2023-07-06 02:50:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11274166", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:50:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3502076", "type": "PubMed"}, "ts": "2023-07-06 02:50:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3502076", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:50:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:50:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11274166", "type": "PubMed"}, "ts": "2023-07-06 02:50:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:51:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01236.44.44"}, "ts": "2023-07-06 02:51:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01236", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:51:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:51:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11021"}, "ts": "2023-07-06 02:51:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11021", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:51:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-06 02:51:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 02:51:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G53208AY"}, "ts": "2023-07-06 02:51:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G53208AY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 02:51:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:51:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30988"}, "ts": "2023-07-06 02:51:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30988", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:51:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:52:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WY07"}, "ts": "2023-07-06 02:52:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WY07", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:52:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P0T7"}, "ts": "2023-07-06 02:52:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P0T7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:52:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z6L0"}, "ts": "2023-07-06 02:52:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z6L0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:52:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28749"}, "ts": "2023-07-06 02:52:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28749", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:52:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00144"}, "ts": "2023-07-06 02:52:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AFH1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 02:53:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2AFH1"}, "ts": "2023-07-06 02:53:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZZ2"}, "ts": "2023-07-06 02:53:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZZ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:53:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:53:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10671552", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 02:53:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10671552", "type": "PubMed"}, "ts": "2023-07-06 02:53:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52735", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:54:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52735"}, "ts": "2023-07-06 02:54:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13688", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:54:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13688"}, "ts": "2023-07-06 02:54:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5UBV8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:55:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5UBV8"}, "ts": "2023-07-06 02:55:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96KJ4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:55:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96KJ4"}, "ts": "2023-07-06 02:55:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O55186"}, "ts": "2023-07-06 02:55:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02091-1"}, "ts": "2023-07-06 02:55:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02545"}, "ts": "2023-07-06 02:56:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BVK8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 02:56:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BVK8"}, "ts": "2023-07-06 02:56:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:56:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15822"}, "ts": "2023-07-06 02:56:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15822", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:57:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TCW7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 02:57:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TCW7.28.28"}, "ts": "2023-07-06 02:57:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQG5"}, "ts": "2023-07-06 02:57:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TEB9-1"}, "ts": "2023-07-06 02:57:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQG5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:58:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TEB9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 02:58:02 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-06 03:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-06 03:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 03:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-06 03:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-06 03:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-06 03:00:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5T3J3.13.13"}, "ts": "2023-07-06 03:00:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T3J3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:00:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKD2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:00:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKD2"}, "ts": "2023-07-06 03:00:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63182-1"}, "ts": "2023-07-06 03:00:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63182-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:00:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92698-1"}, "ts": "2023-07-06 03:00:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A1L443", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:00:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A1L443"}, "ts": "2023-07-06 03:00:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92698-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:00:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92793", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:00:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92793.141.141"}, "ts": "2023-07-06 03:00:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D0F3-1"}, "ts": "2023-07-06 03:00:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QWV4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:00:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QWV4-1"}, "ts": "2023-07-06 03:00:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q56UD9"}, "ts": "2023-07-06 03:01:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q56UD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:01:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00749", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:01:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5ZPR3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:01:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5ZPR3"}, "ts": "2023-07-06 03:01:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:01:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 03:01:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NI77", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 03:01:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NI77"}, "ts": "2023-07-06 03:01:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:02:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91Y74-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:02:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91Y74-1"}, "ts": "2023-07-06 03:02:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92485", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:02:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92485.72.72"}, "ts": "2023-07-06 03:02:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31307407", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 03:02:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31307407", "type": "PubMed"}, "ts": "2023-07-06 03:02:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31307407", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 03:02:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXA5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:03:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60230HH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 03:03:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q811A3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 03:03:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q811A3"}, "ts": "2023-07-06 03:03:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11597188", "type": "PubMed"}, "ts": "2023-07-06 03:03:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11597188", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 03:03:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86WV6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:04:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86WV6"}, "ts": "2023-07-06 03:04:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10828"}, "ts": "2023-07-06 03:04:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NCH0"}, "ts": "2023-07-06 03:04:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NCH0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:04:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:04:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WUM0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:04:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WUM0"}, "ts": "2023-07-06 03:04:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:05:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WUM0"}, "ts": "2023-07-06 03:05:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WUM0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:05:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99376"}, "ts": "2023-07-06 03:05:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99376", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:05:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25311", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:06:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P25311.112.112"}, "ts": "2023-07-06 03:06:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TEV9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:06:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TEV9.417.417"}, "ts": "2023-07-06 03:06:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94907"}, "ts": "2023-07-06 03:06:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94907", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:06:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:06:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WUM0"}, "ts": "2023-07-06 03:06:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WUM0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:06:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IV20", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:07:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IV20"}, "ts": "2023-07-06 03:07:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00144", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:08:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:08:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49961"}, "ts": "2023-07-06 03:08:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49961", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:08:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33203836", "type": "PubMed"}, "ts": "2023-07-06 03:08:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33203836", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 03:08:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33203836", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 03:08:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22888"}, "ts": "2023-07-06 03:09:02 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P68400", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 03:09:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68400", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 03:09:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZWP6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:09:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZWP6"}, "ts": "2023-07-06 03:09:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B0BNB5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:10:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B0BNB5-1"}, "ts": "2023-07-06 03:10:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49759", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:10:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49759"}, "ts": "2023-07-06 03:10:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VIG0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:11:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VIG0"}, "ts": "2023-07-06 03:11:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00476.68.68"}, "ts": "2023-07-06 03:11:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00476", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:11:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95711", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:11:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95711.156.156"}, "ts": "2023-07-06 03:11:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O55186", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:11:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02091-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:11:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-06 03:11:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33309333", "type": "PubMed"}, "ts": "2023-07-06 03:11:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33309333", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 03:11:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75462"}, "ts": "2023-07-06 03:12:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:12:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75462", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:12:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00961"}, "ts": "2023-07-06 03:12:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O88846.98.98"}, "ts": "2023-07-06 03:12:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88846", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:12:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 03:12:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19827", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 03:12:30 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P19827", "cluster_type": "unselected"}, "ts": "2023-07-06 03:12:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9305641", "type": "PubMed"}, "ts": "2023-07-06 03:12:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19827", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 03:12:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9305641", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 03:12:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02545", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:12:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86W10.472.472"}, "ts": "2023-07-06 03:14:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86W10", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:14:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 03:14:24 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P07359", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 03:14:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07359", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 03:14:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07359", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_7) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.0.0 Safari/537.36"}, "ts": "2023-07-06 03:14:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30281", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:14:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30281"}, "ts": "2023-07-06 03:14:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NET4"}, "ts": "2023-07-06 03:16:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NET4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:16:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O96009"}, "ts": "2023-07-06 03:16:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O96009", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:16:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:16:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13421-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:16:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13421-1"}, "ts": "2023-07-06 03:16:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37881RL"}, "ts": "2023-07-06 03:16:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-06 03:16:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02030ZB"}, "ts": "2023-07-06 03:16:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39595FH"}, "ts": "2023-07-06 03:16:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13694XX"}, "ts": "2023-07-06 03:16:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56784JY"}, "ts": "2023-07-06 03:16:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37399XV"}, "ts": "2023-07-06 03:16:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38663NM"}, "ts": "2023-07-06 03:16:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47748JZ"}, "ts": "2023-07-06 03:17:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-06 03:17:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51640FO"}, "ts": "2023-07-06 03:17:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72667IM"}, "ts": "2023-07-06 03:17:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82463GQ"}, "ts": "2023-07-06 03:17:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-06 03:17:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91473PK"}, "ts": "2023-07-06 03:17:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12793SR"}, "ts": "2023-07-06 03:17:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25418HZ"}, "ts": "2023-07-06 03:17:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33791AF"}, "ts": "2023-07-06 03:17:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18627"}, "ts": "2023-07-06 03:17:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18627", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:17:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:17:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9GZV5.105.105"}, "ts": "2023-07-06 03:17:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZV5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:17:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UVK1"}, "ts": "2023-07-06 03:17:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UVK1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:17:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:18:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16109"}, "ts": "2023-07-06 03:18:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16109", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:18:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24700863", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 03:18:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24700863", "type": "PubMed"}, "ts": "2023-07-06 03:18:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:18:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDQ0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:18:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDQ0"}, "ts": "2023-07-06 03:18:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26403SG"}, "ts": "2023-07-06 03:18:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29931IJ"}, "ts": "2023-07-06 03:18:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-06 03:18:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31916IQ"}, "ts": "2023-07-06 03:18:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47681UP"}, "ts": "2023-07-06 03:18:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66760KM"}, "ts": "2023-07-06 03:18:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13439-1"}, "ts": "2023-07-06 03:18:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13439-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:18:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 03:19:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AYD4-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 03:19:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AYD4-1"}, "ts": "2023-07-06 03:19:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26039", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:19:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01718"}, "ts": "2023-07-06 03:19:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01718", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:19:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZJ7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 03:20:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZJ7"}, "ts": "2023-07-06 03:20:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10828", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:20:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49639-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:20:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49639-1"}, "ts": "2023-07-06 03:20:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59595"}, "ts": "2023-07-06 03:20:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59595", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:20:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53602"}, "ts": "2023-07-06 03:20:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18234728", "type": "PubMed"}, "ts": "2023-07-06 03:20:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18234728", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 03:20:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18433", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:21:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P18433.185.185"}, "ts": "2023-07-06 03:21:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:21:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33981"}, "ts": "2023-07-06 03:21:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33981", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:21:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02671"}, "ts": "2023-07-06 03:21:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:22:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZV3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:22:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZV3"}, "ts": "2023-07-06 03:22:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22888", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:24:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13611"}, "ts": "2023-07-06 03:26:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9278457", "type": "PubMed"}, "ts": "2023-07-06 03:26:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9278457", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 03:26:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:26:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25090"}, "ts": "2023-07-06 03:26:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25090", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:26:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q2M3M2.263.263"}, "ts": "2023-07-06 03:28:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2M3M2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:28:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00961", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:28:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61555", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:28:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q61555.485.485"}, "ts": "2023-07-06 03:28:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96NY8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:29:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96NY8"}, "ts": "2023-07-06 03:29:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52823"}, "ts": "2023-07-06 03:29:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52823", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:29:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12796"}, "ts": "2023-07-06 03:29:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12796", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:29:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q18PE1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:29:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q18PE1-1"}, "ts": "2023-07-06 03:29:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23767829", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 03:29:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23767829", "type": "PubMed"}, "ts": "2023-07-06 03:29:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96SF2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:30:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96SF2"}, "ts": "2023-07-06 03:30:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RYS9"}, "ts": "2023-07-06 03:30:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RYS9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:30:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQB3"}, "ts": "2023-07-06 03:30:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 03:30:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NNX1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:31:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NNX1"}, "ts": "2023-07-06 03:31:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 03:31:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17332328", "type": "PubMed"}, "ts": "2023-07-06 03:31:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17332328", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 03:31:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98160-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:31:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:31:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P98160-1.279.279"}, "ts": "2023-07-06 03:31:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6DGG1"}, "ts": "2023-07-06 03:32:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6DGG1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:32:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10359122", "type": "PubMed"}, "ts": "2023-07-06 03:32:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10359122", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 03:32:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:32:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91V01", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:32:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91V01"}, "ts": "2023-07-06 03:32:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95696", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:32:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95696.1055.1055"}, "ts": "2023-07-06 03:32:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G80966KZ"}, "ts": "2023-07-06 03:32:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10153.44.44"}, "ts": "2023-07-06 03:33:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10153", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:33:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N7H5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:33:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N7H5"}, "ts": "2023-07-06 03:33:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:33:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16610", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:33:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16610"}, "ts": "2023-07-06 03:33:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10966456", "type": "PubMed"}, "ts": "2023-07-06 03:34:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10966456", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 03:34:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58161NS"}, "ts": "2023-07-06 03:34:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IX05"}, "ts": "2023-07-06 03:34:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IX05", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:34:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BS35", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:34:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BS35"}, "ts": "2023-07-06 03:34:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P2H3"}, "ts": "2023-07-06 03:35:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P2H3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:35:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K0S0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 03:35:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K0S0"}, "ts": "2023-07-06 03:35:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53602", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:35:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D0S9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 03:35:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D0S9"}, "ts": "2023-07-06 03:35:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "C9JJ37", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:36:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "C9JJ37"}, "ts": "2023-07-06 03:36:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60468"}, "ts": "2023-07-06 03:36:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60468", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:36:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48960", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:36:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48960"}, "ts": "2023-07-06 03:36:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BH82", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:37:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BH82"}, "ts": "2023-07-06 03:37:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PJF5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:37:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6PJF5.585.585"}, "ts": "2023-07-06 03:37:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02671", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:37:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:38:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02952", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:38:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02952"}, "ts": "2023-07-06 03:38:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96NS1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:38:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96NS1"}, "ts": "2023-07-06 03:38:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NT22.259.259"}, "ts": "2023-07-06 03:39:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NT22", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:39:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKG4"}, "ts": "2023-07-06 03:40:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKG4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:40:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "L7N2A0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:40:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "L7N2A0"}, "ts": "2023-07-06 03:40:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UXH1.97.97"}, "ts": "2023-07-06 03:40:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXH1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:40:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16891908", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 03:40:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16891908", "type": "PubMed"}, "ts": "2023-07-06 03:40:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 03:41:07 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 03:41:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 03:41:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VF18"}, "ts": "2023-07-06 03:41:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VF18", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 03:41:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3KRC3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:41:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3KRC3-1"}, "ts": "2023-07-06 03:41:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPZ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:41:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UPZ6"}, "ts": "2023-07-06 03:41:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06576"}, "ts": "2023-07-06 03:41:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06576", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:41:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13611", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:42:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42771-1"}, "ts": "2023-07-06 03:42:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43379", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:42:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43379"}, "ts": "2023-07-06 03:42:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULM0"}, "ts": "2023-07-06 03:42:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULM0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:42:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:42:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KLK9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:42:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KLK9"}, "ts": "2023-07-06 03:42:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O96028"}, "ts": "2023-07-06 03:42:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O96028", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:43:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P2C8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:43:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6P2C8.283.283"}, "ts": "2023-07-06 03:43:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00335DM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 03:43:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00335DM"}, "ts": "2023-07-06 03:43:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G91649BT"}, "ts": "2023-07-06 03:43:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G91649BT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 03:43:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0KL02", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:43:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0KL02"}, "ts": "2023-07-06 03:43:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75909"}, "ts": "2023-07-06 03:43:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75909", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:43:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R0T7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:43:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R0T7-1"}, "ts": "2023-07-06 03:43:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54922"}, "ts": "2023-07-06 03:43:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54922", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:44:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6XKD3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:44:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6XKD3-1"}, "ts": "2023-07-06 03:44:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7759950", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 03:45:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7759950", "type": "PubMed"}, "ts": "2023-07-06 03:45:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88513-1"}, "ts": "2023-07-06 03:45:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HAU0.576.576"}, "ts": "2023-07-06 03:45:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46013"}, "ts": "2023-07-06 03:45:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAU0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:45:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88513-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:45:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01033-1"}, "ts": "2023-07-06 03:45:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K2C7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:46:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K2C7-1"}, "ts": "2023-07-06 03:46:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64253", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:46:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64253"}, "ts": "2023-07-06 03:46:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48163", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:47:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P48163.266.266"}, "ts": "2023-07-06 03:47:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35625", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:47:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35625"}, "ts": "2023-07-06 03:47:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5H4"}, "ts": "2023-07-06 03:47:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5H4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 03:47:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AKX3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:47:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A2AKX3.2450.2450"}, "ts": "2023-07-06 03:47:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NA72.104.104"}, "ts": "2023-07-06 03:47:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NA72", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:47:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IU68"}, "ts": "2023-07-06 03:48:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZVK1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:48:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZVK1"}, "ts": "2023-07-06 03:48:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IU68", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:48:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3TN34"}, "ts": "2023-07-06 03:48:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TN34", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:48:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JI85", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:49:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JI85"}, "ts": "2023-07-06 03:49:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G58161NS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 03:49:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24751536", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 03:50:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24751536", "type": "PubMed"}, "ts": "2023-07-06 03:50:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51580"}, "ts": "2023-07-06 03:50:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4FZU0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 03:51:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4FZU0"}, "ts": "2023-07-06 03:51:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G20983SP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 03:53:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05090", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 03:55:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05090"}, "ts": "2023-07-06 03:55:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O09028"}, "ts": "2023-07-06 03:55:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O09028", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:55:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7490084", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 03:55:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7490084", "type": "PubMed"}, "ts": "2023-07-06 03:55:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02679.78.78"}, "ts": "2023-07-06 03:55:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02679", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:55:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N0W4"}, "ts": "2023-07-06 03:56:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N0W4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:56:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:56:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94804", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:56:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94804.634.634"}, "ts": "2023-07-06 03:56:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16359841", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 03:56:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16359841", "type": "PubMed"}, "ts": "2023-07-06 03:56:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32992989", "type": "PubMed"}, "ts": "2023-07-06 03:57:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32992989", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 03:57:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32992989", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 03:57:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "K7N6B7-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 03:57:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "K7N6B7-1"}, "ts": "2023-07-06 03:57:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NFP4.235.235"}, "ts": "2023-07-06 03:57:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFP4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:57:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K920", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:58:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K920"}, "ts": "2023-07-06 03:58:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42771-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 03:58:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35439", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 03:59:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35439.276.276"}, "ts": "2023-07-06 03:59:50 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-06 04:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-06 04:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 04:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-06 04:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-06 04:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-06 04:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UXK5"}, "ts": "2023-07-06 04:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXK5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:00:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G16986CA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 04:00:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G16986CA"}, "ts": "2023-07-06 04:00:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28482"}, "ts": "2023-07-06 04:01:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28482", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 04:01:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G53402KW"}, "ts": "2023-07-06 04:01:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 04:01:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G53402KW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 04:01:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G53402KW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 04:01:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G53402KW"}, "ts": "2023-07-06 04:01:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 04:01:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53402KW"}, "ts": "2023-07-06 04:01:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90627TW"}, "ts": "2023-07-06 04:01:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85505CT"}, "ts": "2023-07-06 04:01:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69382ZH"}, "ts": "2023-07-06 04:01:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53402KW"}, "ts": "2023-07-06 04:01:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90627TW"}, "ts": "2023-07-06 04:01:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85505CT"}, "ts": "2023-07-06 04:01:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69382ZH"}, "ts": "2023-07-06 04:01:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46013", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:01:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01033-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:01:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66K64-1"}, "ts": "2023-07-06 04:02:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66K64-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:03:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K3D7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 04:03:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K3D7"}, "ts": "2023-07-06 04:03:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1H299-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:04:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B1H299-1"}, "ts": "2023-07-06 04:04:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16648378", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 04:04:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16648378", "type": "PubMed"}, "ts": "2023-07-06 04:04:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32648", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:04:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32648"}, "ts": "2023-07-06 04:04:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16665"}, "ts": "2023-07-06 04:04:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16665", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:04:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:05:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHR4"}, "ts": "2023-07-06 04:05:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHR4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:05:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:05:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKY4"}, "ts": "2023-07-06 04:05:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:05:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02765"}, "ts": "2023-07-06 04:05:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02765", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:05:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7M711", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 04:05:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7M711"}, "ts": "2023-07-06 04:05:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51580", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:06:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10637.58.58"}, "ts": "2023-07-06 04:06:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10637", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:06:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TGY3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:07:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5TGY3.1602.1602"}, "ts": "2023-07-06 04:07:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5TDH0"}, "ts": "2023-07-06 04:08:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TDH0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:08:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXP8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:08:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BXP8.520.520"}, "ts": "2023-07-06 04:08:39 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 04:08:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m8trpt76ludtu79m79w84t4i2ze6tese", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 04:08:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m8trpt76ludtu79m79w84t4i2ze6tese", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 04:08:58 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 04:09:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m8trpt76ludtu79m79w84t4i2ze6tese", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-06 04:09:01 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "lypd3", "term_category": "protein"}, "ts": "2023-07-06 04:09:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m8trpt76ludtu79m79w84t4i2ze6tese", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 04:09:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">9cb15950757fa8468edf32f882e308a2", "user": "m8trpt76ludtu79m79w84t4i2ze6tese", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"lypd3\",\"term_category\":\"protein\"}"}, "ts": "2023-07-06 04:09:11 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 04:09:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9cb15950757fa8468edf32f882e308a2", "user": "m8trpt76ludtu79m79w84t4i2ze6tese", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 04:09:12 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "9cb15950757fa8468edf32f882e308a2", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 04:09:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:09:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12860", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:09:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95274-1"}, "ts": "2023-07-06 04:09:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95274-1", "user": "m8trpt76ludtu79m79w84t4i2ze6tese", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:09:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12860.521.521"}, "ts": "2023-07-06 04:09:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-06 04:09:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 04:09:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5I0E9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:09:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5I0E9"}, "ts": "2023-07-06 04:09:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X02", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:09:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86X02"}, "ts": "2023-07-06 04:09:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86WN1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:10:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86WN1"}, "ts": "2023-07-06 04:10:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11215"}, "ts": "2023-07-06 04:10:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11215", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:10:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q04756.492.492"}, "ts": "2023-07-06 04:10:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04756", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:10:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05362"}, "ts": "2023-07-06 04:11:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16877", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:12:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16877"}, "ts": "2023-07-06 04:12:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02748", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:12:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02748"}, "ts": "2023-07-06 04:12:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37840-1"}, "ts": "2023-07-06 04:12:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 04:13:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8931706", "type": "PubMed"}, "ts": "2023-07-06 04:13:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8931706", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 04:13:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q93009", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:15:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q93009"}, "ts": "2023-07-06 04:15:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:15:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02647", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:15:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02647"}, "ts": "2023-07-06 04:15:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2279700", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 04:15:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2279700", "type": "PubMed"}, "ts": "2023-07-06 04:15:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15256", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:15:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15256.376.376"}, "ts": "2023-07-06 04:15:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35439", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:16:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35439.276.276"}, "ts": "2023-07-06 04:16:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BVQ5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:16:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8BVQ5.27.27"}, "ts": "2023-07-06 04:16:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2A7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:16:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2A7"}, "ts": "2023-07-06 04:16:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35594", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 04:16:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35594"}, "ts": "2023-07-06 04:16:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:16:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IZP9"}, "ts": "2023-07-06 04:16:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZP9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:16:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16473.113.113"}, "ts": "2023-07-06 04:16:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16473", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:16:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28351312", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 04:17:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28351312", "type": "PubMed"}, "ts": "2023-07-06 04:17:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96T92", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:17:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96T92"}, "ts": "2023-07-06 04:17:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13136", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:18:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13136"}, "ts": "2023-07-06 04:18:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F7FA15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:18:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F7FA15"}, "ts": "2023-07-06 04:18:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 04:19:03 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O95433", "cluster_type": "unselected"}, "ts": "2023-07-06 04:19:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95433", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 04:19:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95433", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 04:19:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25092", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:19:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P25092.738.738"}, "ts": "2023-07-06 04:19:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4VC05", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:20:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4VC05"}, "ts": "2023-07-06 04:20:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 04:20:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TN31", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 04:20:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TN31"}, "ts": "2023-07-06 04:20:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00472", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:20:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00472"}, "ts": "2023-07-06 04:20:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-06 04:20:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57321FI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 04:20:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:20:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63ZY3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:20:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63ZY3"}, "ts": "2023-07-06 04:20:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000008"}, "ts": "2023-07-06 04:21:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39738WL"}, "ts": "2023-07-06 04:21:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-06 04:21:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27025MB"}, "ts": "2023-07-06 04:21:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35526"}, "ts": "2023-07-06 04:21:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35526", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:21:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57331KL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 04:21:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57331KL"}, "ts": "2023-07-06 04:21:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95336", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:21:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95336.81.81"}, "ts": "2023-07-06 04:21:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:21:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52298", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:21:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34830316", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 04:22:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34830316", "type": "PubMed"}, "ts": "2023-07-06 04:22:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34830316", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 04:22:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BMB3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 04:22:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BMB3"}, "ts": "2023-07-06 04:22:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AQ92", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:22:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2AQ92"}, "ts": "2023-07-06 04:22:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q920L1"}, "ts": "2023-07-06 04:22:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40692"}, "ts": "2023-07-06 04:23:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40692", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 04:23:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q920L1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:23:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2ASQ1"}, "ts": "2023-07-06 04:24:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2ASQ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:24:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G39738WL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 04:24:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G39738WL"}, "ts": "2023-07-06 04:24:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-06 04:24:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57321FI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 04:24:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02647", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:24:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02647"}, "ts": "2023-07-06 04:24:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32056283", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 04:24:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32056283", "type": "PubMed"}, "ts": "2023-07-06 04:24:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25688", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:25:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25688"}, "ts": "2023-07-06 04:25:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TD47", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:25:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TD47"}, "ts": "2023-07-06 04:25:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57321FI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 04:25:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-06 04:25:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02647"}, "ts": "2023-07-06 04:25:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02647", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:25:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ESZ0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 04:25:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ESZ0"}, "ts": "2023-07-06 04:25:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y289", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:25:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y289"}, "ts": "2023-07-06 04:25:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 04:26:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23584533", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 04:26:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23584533", "type": "PubMed"}, "ts": "2023-07-06 04:26:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08519"}, "ts": "2023-07-06 04:26:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G08146BT"}, "ts": "2023-07-06 04:26:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05362", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:27:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49840", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:27:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49840"}, "ts": "2023-07-06 04:27:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92847"}, "ts": "2023-07-06 04:27:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1K8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:28:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z1K8"}, "ts": "2023-07-06 04:28:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZEJ0"}, "ts": "2023-07-06 04:28:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZEJ0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:28:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12314", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:28:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-06 04:28:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23747254", "type": "PubMed"}, "ts": "2023-07-06 04:29:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23747254", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 04:29:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K4R8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:30:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K4R8"}, "ts": "2023-07-06 04:30:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2RU67"}, "ts": "2023-07-06 04:30:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2RU67", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:30:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G52773YO"}, "ts": "2023-07-06 04:30:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G52773YO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 04:30:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WTL8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:31:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WTL8"}, "ts": "2023-07-06 04:31:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00533", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:31:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00533"}, "ts": "2023-07-06 04:31:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AC1"}, "ts": "2023-07-06 04:31:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 04:32:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1985108", "type": "PubMed"}, "ts": "2023-07-06 04:32:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1985108", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 04:32:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43866", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:32:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43866"}, "ts": "2023-07-06 04:32:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12633874", "type": "PubMed"}, "ts": "2023-07-06 04:33:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12633874", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 04:33:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57321FI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 04:33:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-06 04:33:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27217568", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 04:33:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27217568", "type": "PubMed"}, "ts": "2023-07-06 04:33:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02647", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:33:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02647"}, "ts": "2023-07-06 04:33:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G89354EL"}, "ts": "2023-07-06 04:33:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G89354EL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 04:33:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57321FI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 04:34:48 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-06 04:34:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26255-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:34:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26255-1"}, "ts": "2023-07-06 04:34:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q67FW5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:35:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q67FW5"}, "ts": "2023-07-06 04:35:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02647", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:35:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02647"}, "ts": "2023-07-06 04:35:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VU43", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:35:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VU43.32.32"}, "ts": "2023-07-06 04:36:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04080"}, "ts": "2023-07-06 04:36:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11408587", "type": "PubMed"}, "ts": "2023-07-06 04:36:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11408587", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 04:36:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D541", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 04:36:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D541"}, "ts": "2023-07-06 04:36:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54793", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:36:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54793"}, "ts": "2023-07-06 04:36:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N4L8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 04:36:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N4L8"}, "ts": "2023-07-06 04:36:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15409", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:37:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15409"}, "ts": "2023-07-06 04:37:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NVY1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:37:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NVY1"}, "ts": "2023-07-06 04:37:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63673", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:37:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63673"}, "ts": "2023-07-06 04:37:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13449", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:37:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13449"}, "ts": "2023-07-06 04:37:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57321FI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 04:38:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-06 04:38:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10198040", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 04:38:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10198040", "type": "PubMed"}, "ts": "2023-07-06 04:39:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UNE7-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:39:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UNE7-1.22.22"}, "ts": "2023-07-06 04:39:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00657-1"}, "ts": "2023-07-06 04:39:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00657-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:39:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02647", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:39:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02647"}, "ts": "2023-07-06 04:39:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1AQ85", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 04:39:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B1AQ85"}, "ts": "2023-07-06 04:39:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24509834", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 04:39:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24509834", "type": "PubMed"}, "ts": "2023-07-06 04:39:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q32MD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:40:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q32MD9"}, "ts": "2023-07-06 04:40:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6IEY1.167.167"}, "ts": "2023-07-06 04:41:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IEY1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:41:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q53RT3.187.187"}, "ts": "2023-07-06 04:41:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q53RT3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:41:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08519", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:42:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G08146BT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 04:42:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDB8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:42:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDB8"}, "ts": "2023-07-06 04:42:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30038"}, "ts": "2023-07-06 04:43:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30038", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:43:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92847", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:43:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35173-1"}, "ts": "2023-07-06 04:44:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35173-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:44:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NS40", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:45:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NS40.677.677"}, "ts": "2023-07-06 04:45:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14155.518.518"}, "ts": "2023-07-06 04:45:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14155", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:45:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19404", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:45:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19404"}, "ts": "2023-07-06 04:45:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41145"}, "ts": "2023-07-06 04:46:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41145", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:46:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80ZD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:47:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80ZD9"}, "ts": "2023-07-06 04:47:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:47:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K2I1"}, "ts": "2023-07-06 04:47:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K2I1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:47:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95800", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:47:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95800"}, "ts": "2023-07-06 04:47:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48774-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:47:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48774-1"}, "ts": "2023-07-06 04:47:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7779757", "type": "PubMed"}, "ts": "2023-07-06 04:47:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7779757", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 04:47:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91Z31-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 04:48:01 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q91Z31-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 04:48:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NG13"}, "ts": "2023-07-06 04:48:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NG13", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:48:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y250", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:50:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y250"}, "ts": "2023-07-06 04:50:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06787", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:50:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06787"}, "ts": "2023-07-06 04:50:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VSL9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:51:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VSL9.335.335"}, "ts": "2023-07-06 04:51:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 04:51:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G78502KD"}, "ts": "2023-07-06 04:51:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G78502KD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 04:51:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZQF7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 04:51:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZQF7"}, "ts": "2023-07-06 04:51:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G36445ON"}, "ts": "2023-07-06 04:51:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G36445ON", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 04:51:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04080", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:52:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VFP9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 04:52:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VFP9"}, "ts": "2023-07-06 04:52:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91YY5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:53:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91YY5-1"}, "ts": "2023-07-06 04:53:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UBV2-1.195.195"}, "ts": "2023-07-06 04:53:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBV2-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:53:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10556585", "type": "PubMed"}, "ts": "2023-07-06 04:53:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10556585", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 04:53:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25054", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:54:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P25054.883.883"}, "ts": "2023-07-06 04:54:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 04:54:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60635"}, "ts": "2023-07-06 04:54:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60635", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:54:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11831", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:55:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11831.36.36"}, "ts": "2023-07-06 04:55:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:56:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15750", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:56:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15750.400.400"}, "ts": "2023-07-06 04:56:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRH1.51.51"}, "ts": "2023-07-06 04:56:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRH1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:56:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23467", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:56:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P23467.28.28"}, "ts": "2023-07-06 04:56:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N2R0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 04:56:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N2R0"}, "ts": "2023-07-06 04:56:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P18627.188.188"}, "ts": "2023-07-06 04:58:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:58:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18627", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 04:58:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 04:59:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UHH8"}, "ts": "2023-07-06 04:59:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UHH8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 04:59:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDQ0-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "Performing Global Search"}, "ts": "2023-07-06 04:59:51 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Q8TDQ0-1"}, "ts": "2023-07-06 04:59:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 04:59:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDQ0-1", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Q8TDQ0-1"}, "ts": "2023-07-06 04:59:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 04:59:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14155"}, "ts": "2023-07-06 05:00:01 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-06 05:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14155", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 05:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C546-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C546-1"}, "ts": "2023-07-06 05:00:03 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-06 05:00:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6K0P9.433.433"}, "ts": "2023-07-06 05:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6K0P9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 05:00:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 05:00:09 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-06 05:00:09 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-06 05:00:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-06 05:00:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53582"}, "ts": "2023-07-06 05:00:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53582", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:00:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RZ55-1"}, "ts": "2023-07-06 05:00:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RZ55-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:00:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 05:00:26 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 05:00:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61326", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 05:00:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61326"}, "ts": "2023-07-06 05:00:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VCM7"}, "ts": "2023-07-06 05:00:40 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Q8TDQ0-1", "term_category": "protein"}, "ts": "2023-07-06 05:00:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 05:00:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VCM7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:00:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">b0162bc2bc051eae326d9fe4d4183ecc", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Q8TDQ0-1\",\"term_category\":\"protein\"}"}, "ts": "2023-07-06 05:00:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b0162bc2bc051eae326d9fe4d4183ecc", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 05:00:45 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b0162bc2bc051eae326d9fe4d4183ecc", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 05:00:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35303"}, "ts": "2023-07-06 05:00:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35303", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:01:00 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b0162bc2bc051eae326d9fe4d4183ecc", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}]}, "ts": "2023-07-06 05:01:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b0162bc2bc051eae326d9fe4d4183ecc", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 05:01:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43116"}, "ts": "2023-07-06 05:01:17 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b0162bc2bc051eae326d9fe4d4183ecc", "offset": 1, "sort": "number_proteins", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}]}, "ts": "2023-07-06 05:01:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "AFO66593.1", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "Performing Global Search"}, "ts": "2023-07-06 05:01:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 05:01:52 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "AFO66593.1"}, "ts": "2023-07-06 05:01:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 05:02:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "AFO66593.1", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=AFO66593.1"}, "ts": "2023-07-06 05:02:00 EDT-0400"}, {"api": "/job/init/", "req": {}, "ts": "2023-07-06 05:02:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-06 05:02:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66H84"}, "ts": "2023-07-06 05:02:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66H84", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:02:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01222"}, "ts": "2023-07-06 05:02:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18075-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:02:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18075-1"}, "ts": "2023-07-06 05:02:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "Performing Blast Search.Blast Search query={\"jobtype\":\"blastp\",\"parameters\":{\"seq\":\"MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAKVTPAPTLQRDFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQISTLANELRDSRLANDLRDSGATIRIGIYIGAGICAGLALALIFGALIFKWYSHSKEKIQNLSLISLANLPPSGLANAVAEGIRSEENIYTIEENVYEVEEPNEY\\nYCYVSSRQQPSQPLGCRFAMP\\n\",\"targetdb\":\"canonicalsequences_human\",\"evalue\":0.001,\"num_alignments\":250}}"}, "ts": "2023-07-06 05:02:47 EDT-0400"}, {"api": "/job/addnew/", "req": {"query": {"jobtype": "blastp", "parameters": {"seq": "MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAKVTPAPTLQRDFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQISTLANELRDSRLANDLRDSGATIRIGIYIGAGICAGLALALIFGALIFKWYSHSKEKIQNLSLISLANLPPSGLANAVAEGIRSEENIYTIEENVYEVEEPNEY\nYCYVSSRQQPSQPLGCRFAMP\n", "targetdb": "canonicalsequences_human", "evalue": 0.001, "num_alignments": 250}}}, "ts": "2023-07-06 05:02:48 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 8}, "ts": "2023-07-06 05:02:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">8", "user": "Undecided", "type": "user", "page": "blast", "message": "Blast Search query=8"}, "ts": "2023-07-06 05:02:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8", "user": "Undecided", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-06 05:02:51 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 8}, "ts": "2023-07-06 05:02:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8", "user": "Undecided", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: Q8TDQ0-1, Q96D42-1, Q96H15-1, Q6ZMC9-1, Q9UIR0-1, P78310-1, Q8WVV5-1, Q7KYR7-2, Q96KV6-1"}, "ts": "2023-07-06 05:02:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96KQ7.140.140"}, "ts": "2023-07-06 05:04:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96KQ7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 05:04:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q704Y3"}, "ts": "2023-07-06 05:04:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01189"}, "ts": "2023-07-06 05:04:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BZH8"}, "ts": "2023-07-06 05:04:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BZH8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 05:04:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22674"}, "ts": "2023-07-06 05:05:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22674", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:05:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDQ0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:05:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDQ0-1"}, "ts": "2023-07-06 05:05:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49902", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:05:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49902"}, "ts": "2023-07-06 05:05:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:06:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08760", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:06:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08760"}, "ts": "2023-07-06 05:06:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75157", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:06:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75157"}, "ts": "2023-07-06 05:06:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 05:06:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2P8"}, "ts": "2023-07-06 05:06:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2P8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:06:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12923", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 05:06:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12923.1839.1839"}, "ts": "2023-07-06 05:06:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94986", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 05:07:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94986.1061.1061"}, "ts": "2023-07-06 05:07:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68371"}, "ts": "2023-07-06 05:07:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68371", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:07:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P58658"}, "ts": "2023-07-06 05:08:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZS8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:08:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IZS8"}, "ts": "2023-07-06 05:08:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58658", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:08:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29474"}, "ts": "2023-07-06 05:08:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29474", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:08:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96PC5.492.492"}, "ts": "2023-07-06 05:08:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PC5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 05:08:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RZ56"}, "ts": "2023-07-06 05:09:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q62318.454.454"}, "ts": "2023-07-06 05:09:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RZ56", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 05:09:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62318", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 05:09:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QXM0", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 05:09:54 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9QXM0", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 05:09:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QXM0", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 05:09:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33129760", "type": "PubMed"}, "ts": "2023-07-06 05:10:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33129760", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 05:10:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96921ZU"}, "ts": "2023-07-06 05:10:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:10:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46777"}, "ts": "2023-07-06 05:10:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46777", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:10:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HCJ0.1524.1524"}, "ts": "2023-07-06 05:11:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCJ0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 05:11:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47758"}, "ts": "2023-07-06 05:11:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47758", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 05:11:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13324"}, "ts": "2023-07-06 05:11:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13324", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:11:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 05:13:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06400", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 05:13:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06400.31.31"}, "ts": "2023-07-06 05:13:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PAL1"}, "ts": "2023-07-06 05:13:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PAL1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:13:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGG8"}, "ts": "2023-07-06 05:14:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGG8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 05:14:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ISU1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:14:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ISU1"}, "ts": "2023-07-06 05:14:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07311", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 05:14:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P07311.63.63"}, "ts": "2023-07-06 05:14:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 05:15:03 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 05:15:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 05:15:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "cd46", "user": "Anonymous", "type": "user", "page": "home", "message": "Performing Global Search"}, "ts": "2023-07-06 05:15:07 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "cd46"}, "ts": "2023-07-06 05:15:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 05:15:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "cd46", "user": "Anonymous", "type": "user", "page": "global-search-result", "message": "Global search term=cd46"}, "ts": "2023-07-06 05:15:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 05:15:08 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 05:15:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ddba5b1d7894bff3657f0e993d6bb7b0", "user": "Anonymous", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 05:15:09 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "ddba5b1d7894bff3657f0e993d6bb7b0", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 05:15:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 05:15:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3f3436b3f77a42879f5eb0a170328500", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 05:15:16 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3f3436b3f77a42879f5eb0a170328500", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 05:15:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3f3436b3f77a42879f5eb0a170328500", "user": "Undecided", "type": "error", "page": "glycan-list", "message": "non-existent-search-results error code. list api call"}, "ts": "2023-07-06 05:15:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15529-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:15:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15529-1"}, "ts": "2023-07-06 05:15:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 05:15:25 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 05:15:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15169WU"}, "ts": "2023-07-06 05:15:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76417NN"}, "ts": "2023-07-06 05:15:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 05:15:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25451PN"}, "ts": "2023-07-06 05:15:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-06 05:15:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60177UT"}, "ts": "2023-07-06 05:15:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83229XP"}, "ts": "2023-07-06 05:15:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-06 05:15:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-06 05:15:27 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 05:15:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 05:15:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 05:15:27 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(1)", "term_category": "any"}, "ts": "2023-07-06 05:15:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 05:15:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">bfa65efd2411e4f69cea26fed2706e46", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 05:15:31 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "bfa65efd2411e4f69cea26fed2706e46", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 05:15:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "bfa65efd2411e4f69cea26fed2706e46", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 05:15:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-06 05:15:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-06 05:15:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70994MS"}, "ts": "2023-07-06 05:15:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01614ZM"}, "ts": "2023-07-06 05:15:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36123IU"}, "ts": "2023-07-06 05:15:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65562ZE"}, "ts": "2023-07-06 05:15:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-06 05:15:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-06 05:15:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56682BC"}, "ts": "2023-07-06 05:15:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94435QH"}, "ts": "2023-07-06 05:15:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47180UC"}, "ts": "2023-07-06 05:15:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59126YU"}, "ts": "2023-07-06 05:15:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76355TG"}, "ts": "2023-07-06 05:15:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28052FT"}, "ts": "2023-07-06 05:15:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21507RO"}, "ts": "2023-07-06 05:15:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70593HA"}, "ts": "2023-07-06 05:15:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60605ZN"}, "ts": "2023-07-06 05:15:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63110FE"}, "ts": "2023-07-06 05:15:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32948PW"}, "ts": "2023-07-06 05:15:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09480OP"}, "ts": "2023-07-06 05:15:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57321FI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 05:15:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-06 05:15:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000008"}, "ts": "2023-07-06 05:15:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39738WL"}, "ts": "2023-07-06 05:15:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27025MB"}, "ts": "2023-07-06 05:15:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP59", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:15:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R3Y8"}, "ts": "2023-07-06 05:15:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R3Y8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:16:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP59"}, "ts": "2023-07-06 05:16:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63182-1"}, "ts": "2023-07-06 05:16:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63182-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:16:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UD5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 05:17:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86UD5"}, "ts": "2023-07-06 05:17:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43116", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:17:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26571211", "type": "PubMed"}, "ts": "2023-07-06 05:17:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26571211", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 05:17:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62074", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 05:17:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q62074.264.264"}, "ts": "2023-07-06 05:17:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9ER58.225.225"}, "ts": "2023-07-06 05:18:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ER58", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 05:18:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:18:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94766"}, "ts": "2023-07-06 05:18:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94766", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:18:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13867-1"}, "ts": "2023-07-06 05:18:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-06 05:18:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01222", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:18:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25813380", "type": "PubMed"}, "ts": "2023-07-06 05:18:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25813380", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 05:18:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 05:18:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36123IU"}, "ts": "2023-07-06 05:18:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78536"}, "ts": "2023-07-06 05:18:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78536", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:18:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WXH0.1666.1666"}, "ts": "2023-07-06 05:19:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXH0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 05:19:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:19:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UX73", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:19:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1Y3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:19:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H1Y3"}, "ts": "2023-07-06 05:19:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58170", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 05:20:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P58170"}, "ts": "2023-07-06 05:20:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01189", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:20:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "bfa65efd2411e4f69cea26fed2706e46", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 05:20:53 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "bfa65efd2411e4f69cea26fed2706e46", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 05:20:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 05:20:59 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 05:20:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 05:21:04 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "1095.3966", "term_category": "any"}, "ts": "2023-07-06 05:21:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">b01c5737779d356f2cad336d3ee50f4a", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"1095.3966\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 05:21:04 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b01c5737779d356f2cad336d3ee50f4a", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 05:21:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b01c5737779d356f2cad336d3ee50f4a", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 05:21:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99235VG"}, "ts": "2023-07-06 05:21:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53286JQ"}, "ts": "2023-07-06 05:21:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R4I7"}, "ts": "2023-07-06 05:21:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 05:21:37 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 05:21:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:21:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R4I7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:21:38 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(3)HexNAc(3)", "term_category": "any"}, "ts": "2023-07-06 05:21:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 05:21:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">34d5db580d0b5a92f604d541b834a5a6", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(3)HexNAc(3)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 05:21:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34d5db580d0b5a92f604d541b834a5a6", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 05:21:49 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "34d5db580d0b5a92f604d541b834a5a6", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 05:21:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07483YN"}, "ts": "2023-07-06 05:21:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45889JQ"}, "ts": "2023-07-06 05:21:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11994QC"}, "ts": "2023-07-06 05:21:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29905OR"}, "ts": "2023-07-06 05:21:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45036WQ"}, "ts": "2023-07-06 05:21:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85041WE"}, "ts": "2023-07-06 05:21:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61751GZ"}, "ts": "2023-07-06 05:21:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64481DJ"}, "ts": "2023-07-06 05:21:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35619UY"}, "ts": "2023-07-06 05:21:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95901MC"}, "ts": "2023-07-06 05:21:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03127AL"}, "ts": "2023-07-06 05:21:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61884GF"}, "ts": "2023-07-06 05:21:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96771UL"}, "ts": "2023-07-06 05:21:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85737WG"}, "ts": "2023-07-06 05:21:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47760VS"}, "ts": "2023-07-06 05:21:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27251WT"}, "ts": "2023-07-06 05:21:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11908FF"}, "ts": "2023-07-06 05:21:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88673AA"}, "ts": "2023-07-06 05:21:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97831CJ"}, "ts": "2023-07-06 05:21:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01600VV"}, "ts": "2023-07-06 05:21:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43360", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:22:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43360"}, "ts": "2023-07-06 05:22:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3LXA3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:22:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3LXA3"}, "ts": "2023-07-06 05:22:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P49790.1017.1017"}, "ts": "2023-07-06 05:22:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49790", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 05:22:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14866"}, "ts": "2023-07-06 05:22:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14866", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:22:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LZZ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:23:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LZZ3"}, "ts": "2023-07-06 05:23:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 05:23:24 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 05:23:24 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(1)", "term_category": "any"}, "ts": "2023-07-06 05:23:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 05:23:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">bfa65efd2411e4f69cea26fed2706e46", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 05:23:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "bfa65efd2411e4f69cea26fed2706e46", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 05:23:28 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "bfa65efd2411e4f69cea26fed2706e46", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 05:23:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46662"}, "ts": "2023-07-06 05:25:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46662"}, "ts": "2023-07-06 05:25:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9705348", "type": "PubMed"}, "ts": "2023-07-06 05:25:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9705348", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 05:25:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:26:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQ74", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:26:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQ74"}, "ts": "2023-07-06 05:26:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96921ZU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 05:26:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13473-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 05:26:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13473-1.32.32"}, "ts": "2023-07-06 05:26:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JP9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 05:26:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96JP9.154.154"}, "ts": "2023-07-06 05:26:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08588"}, "ts": "2023-07-06 05:27:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y267", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:27:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15431"}, "ts": "2023-07-06 05:27:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BQB4"}, "ts": "2023-07-06 05:27:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BQB4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:27:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13123", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 05:28:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13123.485.485"}, "ts": "2023-07-06 05:28:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 05:28:29 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 05:28:29 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "G77513SG", "term_category": "any"}, "ts": "2023-07-06 05:28:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 05:28:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">ed905f6d3588f137651d158d882cac4f", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"G77513SG\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 05:28:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ed905f6d3588f137651d158d882cac4f", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 05:28:33 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "ed905f6d3588f137651d158d882cac4f", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 05:28:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77513SG"}, "ts": "2023-07-06 05:28:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46748BU"}, "ts": "2023-07-06 05:28:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11457RF"}, "ts": "2023-07-06 05:28:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94217FB"}, "ts": "2023-07-06 05:28:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59970QL"}, "ts": "2023-07-06 05:28:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58272ZE"}, "ts": "2023-07-06 05:28:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18519LX"}, "ts": "2023-07-06 05:28:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68053UD"}, "ts": "2023-07-06 05:28:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94971CC"}, "ts": "2023-07-06 05:28:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10651WD"}, "ts": "2023-07-06 05:28:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15173TI"}, "ts": "2023-07-06 05:28:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57144YM"}, "ts": "2023-07-06 05:28:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86718YQ"}, "ts": "2023-07-06 05:28:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60430KO"}, "ts": "2023-07-06 05:28:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31119YY"}, "ts": "2023-07-06 05:28:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63342TJ"}, "ts": "2023-07-06 05:28:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46926OL"}, "ts": "2023-07-06 05:28:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16144PA"}, "ts": "2023-07-06 05:28:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80147HT"}, "ts": "2023-07-06 05:28:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86199GK"}, "ts": "2023-07-06 05:28:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G77513SG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 05:28:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G77513SG"}, "ts": "2023-07-06 05:28:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49139YY"}, "ts": "2023-07-06 05:28:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 05:29:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BJE1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 05:29:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BJE1"}, "ts": "2023-07-06 05:29:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34273906", "type": "PubMed"}, "ts": "2023-07-06 05:29:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34273906", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 05:29:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08727", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 05:30:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08727"}, "ts": "2023-07-06 05:30:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21156796", "type": "PubMed"}, "ts": "2023-07-06 05:30:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21156796", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 05:30:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15676282", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 05:30:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15676282", "type": "PubMed"}, "ts": "2023-07-06 05:30:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52875-1"}, "ts": "2023-07-06 05:30:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52875-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:30:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ed905f6d3588f137651d158d882cac4f", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 05:30:48 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "ed905f6d3588f137651d158d882cac4f", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 05:30:48 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 05:30:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 05:30:52 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "G61337RI", "term_category": "any"}, "ts": "2023-07-06 05:30:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 05:30:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">c96fa5b49a4d293d45367ee514438f40", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"G61337RI\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 05:30:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "c96fa5b49a4d293d45367ee514438f40", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 05:30:55 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "c96fa5b49a4d293d45367ee514438f40", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 05:30:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61337RI"}, "ts": "2023-07-06 05:30:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13260JU"}, "ts": "2023-07-06 05:30:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27726WH"}, "ts": "2023-07-06 05:30:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33350UC"}, "ts": "2023-07-06 05:30:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26596ON"}, "ts": "2023-07-06 05:30:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53031QB"}, "ts": "2023-07-06 05:30:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58580BP"}, "ts": "2023-07-06 05:30:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91313DF"}, "ts": "2023-07-06 05:30:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86372GF"}, "ts": "2023-07-06 05:30:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60949GI"}, "ts": "2023-07-06 05:30:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40757HO"}, "ts": "2023-07-06 05:30:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34863TS"}, "ts": "2023-07-06 05:30:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29849JL"}, "ts": "2023-07-06 05:30:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83261UB"}, "ts": "2023-07-06 05:30:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19806ZW"}, "ts": "2023-07-06 05:30:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62437NU"}, "ts": "2023-07-06 05:30:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88678EQ"}, "ts": "2023-07-06 05:30:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95304AA"}, "ts": "2023-07-06 05:30:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06366AC"}, "ts": "2023-07-06 05:30:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35433", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:30:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70074GW"}, "ts": "2023-07-06 05:30:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35433"}, "ts": "2023-07-06 05:30:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61337RI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 05:31:08 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61337RI"}, "ts": "2023-07-06 05:31:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26550KF"}, "ts": "2023-07-06 05:31:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10810"}, "ts": "2023-07-06 05:31:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10810", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:31:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:31:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O76095"}, "ts": "2023-07-06 05:31:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76095", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:31:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37237"}, "ts": "2023-07-06 05:31:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37237", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 05:31:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-06 05:31:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 05:31:58 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P26232", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 05:31:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26232", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 05:31:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PE7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:32:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PE7"}, "ts": "2023-07-06 05:32:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TEI4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:32:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3TEI4-1"}, "ts": "2023-07-06 05:32:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54707", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:33:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54707"}, "ts": "2023-07-06 05:33:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6I9", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 05:33:38 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9Y6I9", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 05:33:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48615", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 05:33:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48615"}, "ts": "2023-07-06 05:33:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TH1"}, "ts": "2023-07-06 05:33:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13867-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:34:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00390", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 05:34:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P00390.109.109"}, "ts": "2023-07-06 05:34:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2GV76", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:34:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2GV76"}, "ts": "2023-07-06 05:34:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:35:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6N075", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:35:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6N075"}, "ts": "2023-07-06 05:35:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60603"}, "ts": "2023-07-06 05:35:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "c96fa5b49a4d293d45367ee514438f40", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 05:36:05 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "c96fa5b49a4d293d45367ee514438f40", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 05:36:05 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 05:36:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 05:36:10 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 05:36:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 05:36:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 05:36:14 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "G59126YU", "term_category": "any"}, "ts": "2023-07-06 05:36:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 05:36:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">07a848f921bc31674ed8295213f26c52", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"G59126YU\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 05:36:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "07a848f921bc31674ed8295213f26c52", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 05:36:17 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "07a848f921bc31674ed8295213f26c52", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 05:36:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49644CL"}, "ts": "2023-07-06 05:36:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43761FR"}, "ts": "2023-07-06 05:36:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61023PY"}, "ts": "2023-07-06 05:36:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20393XK"}, "ts": "2023-07-06 05:36:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02657CQ"}, "ts": "2023-07-06 05:36:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06795LS"}, "ts": "2023-07-06 05:36:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38037QN"}, "ts": "2023-07-06 05:36:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22945AN"}, "ts": "2023-07-06 05:36:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16036RF"}, "ts": "2023-07-06 05:36:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68797ZS"}, "ts": "2023-07-06 05:36:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95742MR"}, "ts": "2023-07-06 05:36:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68195QP"}, "ts": "2023-07-06 05:36:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80031VE"}, "ts": "2023-07-06 05:36:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87313XJ"}, "ts": "2023-07-06 05:36:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33885RT"}, "ts": "2023-07-06 05:36:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08961BG"}, "ts": "2023-07-06 05:36:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67719GQ"}, "ts": "2023-07-06 05:36:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55677NY"}, "ts": "2023-07-06 05:36:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38025DM"}, "ts": "2023-07-06 05:36:20 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G59126YU"}, "ts": "2023-07-06 05:36:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G59126YU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 05:36:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-06 05:36:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63053UD"}, "ts": "2023-07-06 05:36:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000034"}, "ts": "2023-07-06 05:36:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000055"}, "ts": "2023-07-06 05:36:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 05:36:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33766086", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 05:36:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33766086", "type": "PubMed"}, "ts": "2023-07-06 05:36:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UM22"}, "ts": "2023-07-06 05:36:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UM22", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:36:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AX1"}, "ts": "2023-07-06 05:36:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AX1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 05:36:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49257-1"}, "ts": "2023-07-06 05:36:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49257-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:36:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86YT9"}, "ts": "2023-07-06 05:36:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YT9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:37:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04167", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:37:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04167"}, "ts": "2023-07-06 05:37:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:37:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04828", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:37:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04828"}, "ts": "2023-07-06 05:37:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3X6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 05:37:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N3X6"}, "ts": "2023-07-06 05:37:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "07a848f921bc31674ed8295213f26c52", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 05:37:42 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "07a848f921bc31674ed8295213f26c52", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 05:37:42 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 05:37:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 05:37:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63096"}, "ts": "2023-07-06 05:37:45 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 05:37:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 05:37:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 05:37:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01592"}, "ts": "2023-07-06 05:37:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01592", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:37:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08581"}, "ts": "2023-07-06 05:37:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 05:37:57 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "G20393XK", "term_category": "any"}, "ts": "2023-07-06 05:37:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">cc7039252ac0cce9a6609b67a5a48922", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"G20393XK\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 05:37:57 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "cc7039252ac0cce9a6609b67a5a48922", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 05:37:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "cc7039252ac0cce9a6609b67a5a48922", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 05:37:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68639CF"}, "ts": "2023-07-06 05:37:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G20393XK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 05:38:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G20393XK"}, "ts": "2023-07-06 05:38:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKB3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:38:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKB3"}, "ts": "2023-07-06 05:38:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "cc7039252ac0cce9a6609b67a5a48922", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 05:38:30 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "cc7039252ac0cce9a6609b67a5a48922", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 05:38:30 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 05:38:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 05:38:32 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 05:38:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 05:38:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 05:38:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 05:38:36 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(1)Hex(1)Fuc(1)NeuGc(1)", "term_category": "any"}, "ts": "2023-07-06 05:38:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(1)Hex(1)Fuc(1)NeuGc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 05:38:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39688", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 05:38:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P39688.185.185"}, "ts": "2023-07-06 05:38:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 05:38:48 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(1)Hex(1)Fuc(1)NeuGc(1)", "term_category": "any"}, "ts": "2023-07-06 05:38:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(1)Hex(1)Fuc(1)NeuGc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 05:38:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08590", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 05:38:59 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O08590", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 05:39:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08590", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 05:39:00 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "G17689DH", "term_category": "any"}, "ts": "2023-07-06 05:39:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 05:39:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">6db0a535f896f31ad73eeecc521ee9e7", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"G17689DH\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 05:39:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6db0a535f896f31ad73eeecc521ee9e7", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 05:39:16 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6db0a535f896f31ad73eeecc521ee9e7", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 05:39:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 05:39:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08146BT"}, "ts": "2023-07-06 05:39:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86750HK"}, "ts": "2023-07-06 05:39:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93822DY"}, "ts": "2023-07-06 05:39:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81459MV"}, "ts": "2023-07-06 05:39:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37626XQ"}, "ts": "2023-07-06 05:39:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29255IL"}, "ts": "2023-07-06 05:39:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64132UH"}, "ts": "2023-07-06 05:39:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24005JZ"}, "ts": "2023-07-06 05:39:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08606CV"}, "ts": "2023-07-06 05:39:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67393WG"}, "ts": "2023-07-06 05:39:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72956NR"}, "ts": "2023-07-06 05:39:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30048DT"}, "ts": "2023-07-06 05:39:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48844XN"}, "ts": "2023-07-06 05:39:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-06 05:39:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74026TS"}, "ts": "2023-07-06 05:39:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94019IV"}, "ts": "2023-07-06 05:39:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90889KG"}, "ts": "2023-07-06 05:39:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61734US"}, "ts": "2023-07-06 05:39:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92180XB"}, "ts": "2023-07-06 05:39:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 05:39:22 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 05:39:23 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(2)", "term_category": "any"}, "ts": "2023-07-06 05:40:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 05:40:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">5bf74df5be5e238aeb492053c9c9fdd7", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(2)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 05:40:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "5bf74df5be5e238aeb492053c9c9fdd7", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 05:40:28 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "5bf74df5be5e238aeb492053c9c9fdd7", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 05:40:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55220VL"}, "ts": "2023-07-06 05:40:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80966KZ"}, "ts": "2023-07-06 05:40:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82348BZ"}, "ts": "2023-07-06 05:40:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60230HH"}, "ts": "2023-07-06 05:40:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22768VO"}, "ts": "2023-07-06 05:40:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14548ZL"}, "ts": "2023-07-06 05:40:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37135JQ"}, "ts": "2023-07-06 05:40:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83161QT"}, "ts": "2023-07-06 05:40:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68668TB"}, "ts": "2023-07-06 05:40:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09775CH"}, "ts": "2023-07-06 05:40:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40702WU"}, "ts": "2023-07-06 05:40:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82020ZR"}, "ts": "2023-07-06 05:40:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93993PD"}, "ts": "2023-07-06 05:40:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11460AB"}, "ts": "2023-07-06 05:40:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09724ZC"}, "ts": "2023-07-06 05:40:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87618BG"}, "ts": "2023-07-06 05:40:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99858XP"}, "ts": "2023-07-06 05:40:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-06 05:40:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19958IL"}, "ts": "2023-07-06 05:40:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15956KF"}, "ts": "2023-07-06 05:40:32 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "5bf74df5be5e238aeb492053c9c9fdd7", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 05:40:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "5bf74df5be5e238aeb492053c9c9fdd7", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 05:40:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64973KT"}, "ts": "2023-07-06 05:40:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60890ZT"}, "ts": "2023-07-06 05:40:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00033MO"}, "ts": "2023-07-06 05:40:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97345NY"}, "ts": "2023-07-06 05:40:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12396GB"}, "ts": "2023-07-06 05:40:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42797SX"}, "ts": "2023-07-06 05:40:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16370GQ"}, "ts": "2023-07-06 05:40:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49854OS"}, "ts": "2023-07-06 05:40:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77477NL"}, "ts": "2023-07-06 05:40:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00035MO"}, "ts": "2023-07-06 05:40:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94514IB"}, "ts": "2023-07-06 05:40:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85608AG"}, "ts": "2023-07-06 05:40:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32723SL"}, "ts": "2023-07-06 05:40:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25780HH"}, "ts": "2023-07-06 05:40:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63334FZ"}, "ts": "2023-07-06 05:40:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25323VU"}, "ts": "2023-07-06 05:40:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91875JA"}, "ts": "2023-07-06 05:40:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35226"}, "ts": "2023-07-06 05:40:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z7G8"}, "ts": "2023-07-06 05:40:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7G8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:41:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46662", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:41:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46662", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:41:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00035MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 05:41:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00035MO"}, "ts": "2023-07-06 05:41:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27391WQ"}, "ts": "2023-07-06 05:41:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94131HY"}, "ts": "2023-07-06 05:41:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86947FH"}, "ts": "2023-07-06 05:41:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "ni4l0nwi4feggvl7fzr0pin68gxb1juk", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 05:41:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "ni4l0nwi4feggvl7fzr0pin68gxb1juk", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 05:41:25 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 05:41:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55347"}, "ts": "2023-07-06 05:41:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8853987", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 05:42:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8853987", "type": "PubMed"}, "ts": "2023-07-06 05:42:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A8MV24"}, "ts": "2023-07-06 05:42:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8MV24", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:42:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18910"}, "ts": "2023-07-06 05:42:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11362-1"}, "ts": "2023-07-06 05:42:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18910", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:42:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11362-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:42:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11172", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:42:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "5bf74df5be5e238aeb492053c9c9fdd7", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 05:42:41 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "5bf74df5be5e238aeb492053c9c9fdd7", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 05:42:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11172"}, "ts": "2023-07-06 05:42:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63086", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 05:42:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63086"}, "ts": "2023-07-06 05:42:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 05:42:49 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 05:42:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 05:42:49 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 05:42:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 05:42:49 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)", "term_category": "any"}, "ts": "2023-07-06 05:42:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 05:42:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">269b8e3e0e2d48002b2d4a6505934c8a", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 05:42:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 05:42:53 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 05:42:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:42:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16949"}, "ts": "2023-07-06 05:42:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16949", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:42:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16828VN"}, "ts": "2023-07-06 05:42:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12398HZ"}, "ts": "2023-07-06 05:42:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69411IG"}, "ts": "2023-07-06 05:42:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65890UA"}, "ts": "2023-07-06 05:42:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14996IQ"}, "ts": "2023-07-06 05:42:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53962WT"}, "ts": "2023-07-06 05:42:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61334IA"}, "ts": "2023-07-06 05:42:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06209KS"}, "ts": "2023-07-06 05:42:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08520NM"}, "ts": "2023-07-06 05:42:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11637WL"}, "ts": "2023-07-06 05:42:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51367TM"}, "ts": "2023-07-06 05:42:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37166HP"}, "ts": "2023-07-06 05:42:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82942ZJ"}, "ts": "2023-07-06 05:42:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35599NO"}, "ts": "2023-07-06 05:42:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33734YD"}, "ts": "2023-07-06 05:42:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84852GW"}, "ts": "2023-07-06 05:42:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04576KS"}, "ts": "2023-07-06 05:42:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44617UT"}, "ts": "2023-07-06 05:42:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97720QM"}, "ts": "2023-07-06 05:42:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08588", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:43:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 05:43:00 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 05:43:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07677VL"}, "ts": "2023-07-06 05:43:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33508VK"}, "ts": "2023-07-06 05:43:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04765GH"}, "ts": "2023-07-06 05:43:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01457KB"}, "ts": "2023-07-06 05:43:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86537AD"}, "ts": "2023-07-06 05:43:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34100DU"}, "ts": "2023-07-06 05:43:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30871VQ"}, "ts": "2023-07-06 05:43:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41424HD"}, "ts": "2023-07-06 05:43:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69500TM"}, "ts": "2023-07-06 05:43:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86186US"}, "ts": "2023-07-06 05:43:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23438NR"}, "ts": "2023-07-06 05:43:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05848DX"}, "ts": "2023-07-06 05:43:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70125XL"}, "ts": "2023-07-06 05:43:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52144RR"}, "ts": "2023-07-06 05:43:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66419SM"}, "ts": "2023-07-06 05:43:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29231AT"}, "ts": "2023-07-06 05:43:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37653KL"}, "ts": "2023-07-06 05:43:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07932PU"}, "ts": "2023-07-06 05:43:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03670RH"}, "ts": "2023-07-06 05:43:03 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q00342", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 05:43:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00342", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 05:43:11 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "offset": 21, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 05:43:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58972ZH"}, "ts": "2023-07-06 05:43:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70783BY"}, "ts": "2023-07-06 05:43:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32652KI"}, "ts": "2023-07-06 05:43:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65124UZ"}, "ts": "2023-07-06 05:43:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25538MM"}, "ts": "2023-07-06 05:43:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47325XO"}, "ts": "2023-07-06 05:43:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51827GO"}, "ts": "2023-07-06 05:43:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05380VG"}, "ts": "2023-07-06 05:43:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74038AG"}, "ts": "2023-07-06 05:43:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53435KM"}, "ts": "2023-07-06 05:43:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24363HJ"}, "ts": "2023-07-06 05:43:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04114CX"}, "ts": "2023-07-06 05:43:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54896JZ"}, "ts": "2023-07-06 05:43:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38684VZ"}, "ts": "2023-07-06 05:43:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60067UC"}, "ts": "2023-07-06 05:43:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60734PM"}, "ts": "2023-07-06 05:43:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39523KI"}, "ts": "2023-07-06 05:43:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17810KS"}, "ts": "2023-07-06 05:43:39 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "offset": 41, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 05:43:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15431", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:43:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96416NB"}, "ts": "2023-07-06 05:43:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80690PN"}, "ts": "2023-07-06 05:43:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70528XB"}, "ts": "2023-07-06 05:43:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82698QQ"}, "ts": "2023-07-06 05:43:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85282JA"}, "ts": "2023-07-06 05:43:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26724PP"}, "ts": "2023-07-06 05:43:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04908IA"}, "ts": "2023-07-06 05:43:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22516UQ"}, "ts": "2023-07-06 05:43:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88908BO"}, "ts": "2023-07-06 05:43:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31317XB"}, "ts": "2023-07-06 05:43:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12035CL"}, "ts": "2023-07-06 05:43:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12679QG"}, "ts": "2023-07-06 05:43:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52706RS"}, "ts": "2023-07-06 05:43:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48809BS"}, "ts": "2023-07-06 05:43:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48856VC"}, "ts": "2023-07-06 05:43:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51984GX"}, "ts": "2023-07-06 05:43:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07575HR"}, "ts": "2023-07-06 05:43:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71990XF"}, "ts": "2023-07-06 05:43:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38466KL"}, "ts": "2023-07-06 05:43:49 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "offset": 41, "sort": "hit_score", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 05:43:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90935OH"}, "ts": "2023-07-06 05:43:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91447PN"}, "ts": "2023-07-06 05:43:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39963CO"}, "ts": "2023-07-06 05:43:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02864GJ"}, "ts": "2023-07-06 05:43:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63499JS"}, "ts": "2023-07-06 05:43:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74163WT"}, "ts": "2023-07-06 05:43:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89019WK"}, "ts": "2023-07-06 05:43:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95812KU"}, "ts": "2023-07-06 05:43:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03211IX"}, "ts": "2023-07-06 05:43:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91843YE"}, "ts": "2023-07-06 05:43:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72554ZD"}, "ts": "2023-07-06 05:43:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85342DQ"}, "ts": "2023-07-06 05:43:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81991FU"}, "ts": "2023-07-06 05:43:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86227LF"}, "ts": "2023-07-06 05:43:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02972HU"}, "ts": "2023-07-06 05:43:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13764NR"}, "ts": "2023-07-06 05:43:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64111DY"}, "ts": "2023-07-06 05:43:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44159MM"}, "ts": "2023-07-06 05:43:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24123DL"}, "ts": "2023-07-06 05:43:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15073KL"}, "ts": "2023-07-06 05:43:52 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "offset": 41, "sort": "mass", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 05:43:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79265CF"}, "ts": "2023-07-06 05:43:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54578OZ"}, "ts": "2023-07-06 05:43:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19793PI"}, "ts": "2023-07-06 05:43:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65537UV"}, "ts": "2023-07-06 05:43:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50824HV"}, "ts": "2023-07-06 05:43:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73748DH"}, "ts": "2023-07-06 05:43:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65268SY"}, "ts": "2023-07-06 05:43:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49088AN"}, "ts": "2023-07-06 05:43:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87310ZF"}, "ts": "2023-07-06 05:43:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49671FR"}, "ts": "2023-07-06 05:43:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86454PA"}, "ts": "2023-07-06 05:43:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82133EG"}, "ts": "2023-07-06 05:43:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00430ZK"}, "ts": "2023-07-06 05:43:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74758HW"}, "ts": "2023-07-06 05:43:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67129FV"}, "ts": "2023-07-06 05:43:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52448OU"}, "ts": "2023-07-06 05:43:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26020AK"}, "ts": "2023-07-06 05:43:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22803YZ"}, "ts": "2023-07-06 05:43:54 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "offset": 41, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 05:43:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3TWL2"}, "ts": "2023-07-06 05:43:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23501RV"}, "ts": "2023-07-06 05:44:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74491LU"}, "ts": "2023-07-06 05:44:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67998OP"}, "ts": "2023-07-06 05:44:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07395MI"}, "ts": "2023-07-06 05:44:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05405HZ"}, "ts": "2023-07-06 05:44:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85887XT"}, "ts": "2023-07-06 05:44:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TWL2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:44:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67212WQ"}, "ts": "2023-07-06 05:44:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07898UR"}, "ts": "2023-07-06 05:44:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38799GI"}, "ts": "2023-07-06 05:44:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74804ZA"}, "ts": "2023-07-06 05:44:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47520QY"}, "ts": "2023-07-06 05:44:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98753FD"}, "ts": "2023-07-06 05:44:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53206FD"}, "ts": "2023-07-06 05:44:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09980KC"}, "ts": "2023-07-06 05:44:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71743JP"}, "ts": "2023-07-06 05:44:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56913CG"}, "ts": "2023-07-06 05:44:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10023KT"}, "ts": "2023-07-06 05:44:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14870EV"}, "ts": "2023-07-06 05:44:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46681XX"}, "ts": "2023-07-06 05:44:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16214HG"}, "ts": "2023-07-06 05:44:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43474"}, "ts": "2023-07-06 05:44:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43474", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:44:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08874", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 05:44:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08874.414.414"}, "ts": "2023-07-06 05:44:44 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 05:44:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47947JW"}, "ts": "2023-07-06 05:44:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60735SE"}, "ts": "2023-07-06 05:44:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77152WY"}, "ts": "2023-07-06 05:44:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22745SA"}, "ts": "2023-07-06 05:44:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21100PW"}, "ts": "2023-07-06 05:44:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65137ZN"}, "ts": "2023-07-06 05:44:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84641CT"}, "ts": "2023-07-06 05:44:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18892PE"}, "ts": "2023-07-06 05:44:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28134WJ"}, "ts": "2023-07-06 05:44:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88162NH"}, "ts": "2023-07-06 05:44:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66244VX"}, "ts": "2023-07-06 05:44:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29432PD"}, "ts": "2023-07-06 05:44:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20174EZ"}, "ts": "2023-07-06 05:44:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35689CT"}, "ts": "2023-07-06 05:44:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58314JG"}, "ts": "2023-07-06 05:44:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00038MO"}, "ts": "2023-07-06 05:44:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40740AD"}, "ts": "2023-07-06 05:44:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60275BG"}, "ts": "2023-07-06 05:44:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92378XH"}, "ts": "2023-07-06 05:44:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G47947JW"}, "ts": "2023-07-06 05:45:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G47947JW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 05:45:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 05:45:37 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 05:45:37 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 05:45:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44483CH"}, "ts": "2023-07-06 05:45:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97746VZ"}, "ts": "2023-07-06 05:45:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55444WK"}, "ts": "2023-07-06 05:45:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20899EQ"}, "ts": "2023-07-06 05:45:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83676GD"}, "ts": "2023-07-06 05:45:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54992WG"}, "ts": "2023-07-06 05:45:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46541XC"}, "ts": "2023-07-06 05:45:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32683MW"}, "ts": "2023-07-06 05:45:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52388RL"}, "ts": "2023-07-06 05:45:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45275NN"}, "ts": "2023-07-06 05:45:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19382QM"}, "ts": "2023-07-06 05:45:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53958ZQ"}, "ts": "2023-07-06 05:45:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01659IT"}, "ts": "2023-07-06 05:45:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51421KN"}, "ts": "2023-07-06 05:45:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62359ED"}, "ts": "2023-07-06 05:45:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07517TD"}, "ts": "2023-07-06 05:45:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22732RT"}, "ts": "2023-07-06 05:45:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64873JT"}, "ts": "2023-07-06 05:45:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24661ER"}, "ts": "2023-07-06 05:45:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28096RS"}, "ts": "2023-07-06 05:45:45 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 05:45:45 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 05:45:49 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": []}, "ts": "2023-07-06 05:45:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34748JC"}, "ts": "2023-07-06 05:45:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40788LX"}, "ts": "2023-07-06 05:45:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71304WV"}, "ts": "2023-07-06 05:45:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22185MF"}, "ts": "2023-07-06 05:45:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37177QE"}, "ts": "2023-07-06 05:45:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34450TH"}, "ts": "2023-07-06 05:45:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75338PT"}, "ts": "2023-07-06 05:45:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50435ON"}, "ts": "2023-07-06 05:45:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46762MX"}, "ts": "2023-07-06 05:45:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BND5"}, "ts": "2023-07-06 05:46:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BND5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:46:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10276.77.77"}, "ts": "2023-07-06 05:47:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10276", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 05:47:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDX7"}, "ts": "2023-07-06 05:47:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDX7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:47:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A4D1P6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 05:47:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A4D1P6.241.241"}, "ts": "2023-07-06 05:47:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P45953"}, "ts": "2023-07-06 05:47:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P45953", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 05:47:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G34748JC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 05:47:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G34748JC"}, "ts": "2023-07-06 05:47:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34632KL"}, "ts": "2023-07-06 05:47:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P69905"}, "ts": "2023-07-06 05:47:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G34748JC", "user": "Undecided", "type": "user", "page": "glycan", "message": "Performing Direct Search"}, "ts": "2023-07-06 05:47:56 EDT-0400"}, {"api": "/glycan/search/", "req": {"composition": [{"residue": "hexnac", "min": 3, "max": 3}]}, "ts": "2023-07-06 05:47:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G34748JC>e99af4c72a900932f10b424ecaffb829", "user": "Undecided", "type": "user", "page": "glycan", "message": "Direct Search query={\"composition\":[{\"residue\":\"hexnac\",\"min\":3,\"max\":3}]}"}, "ts": "2023-07-06 05:48:04 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "e99af4c72a900932f10b424ecaffb829", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 05:48:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "e99af4c72a900932f10b424ecaffb829", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 05:48:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61833XV"}, "ts": "2023-07-06 05:48:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00037MO"}, "ts": "2023-07-06 05:48:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86499WY"}, "ts": "2023-07-06 05:48:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19369OY"}, "ts": "2023-07-06 05:48:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83009HN"}, "ts": "2023-07-06 05:48:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27119CB"}, "ts": "2023-07-06 05:48:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66713JJ"}, "ts": "2023-07-06 05:48:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P032-1"}, "ts": "2023-07-06 05:48:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P032-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:48:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G51984GX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 05:48:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G51984GX"}, "ts": "2023-07-06 05:48:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGY6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:48:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGY6"}, "ts": "2023-07-06 05:48:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CJ12", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 05:48:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8CJ12.178.178"}, "ts": "2023-07-06 05:48:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30153-1"}, "ts": "2023-07-06 05:49:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05556"}, "ts": "2023-07-06 05:49:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:50:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13131"}, "ts": "2023-07-06 05:50:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13131", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:50:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30379171", "type": "PubMed"}, "ts": "2023-07-06 05:50:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 05:50:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30379171", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 05:50:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35632"}, "ts": "2023-07-06 05:50:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2557900", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 05:50:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2557900", "type": "PubMed"}, "ts": "2023-07-06 05:50:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2557900", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 05:50:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N7X4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:50:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N7X4"}, "ts": "2023-07-06 05:50:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00754", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:50:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00754"}, "ts": "2023-07-06 05:50:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:50:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88693", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:50:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88693"}, "ts": "2023-07-06 05:50:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60603", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:51:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A3J1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:52:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A3J1-1"}, "ts": "2023-07-06 05:52:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04070"}, "ts": "2023-07-06 05:53:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:53:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96F07"}, "ts": "2023-07-06 05:53:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96F07", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:53:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63096", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:53:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08581", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:53:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BRN9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:54:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BRN9"}, "ts": "2023-07-06 05:54:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60895"}, "ts": "2023-07-06 05:54:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60895", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:54:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 05:55:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31784560", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 05:55:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31784560", "type": "PubMed"}, "ts": "2023-07-06 05:55:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07919", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 05:55:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07919"}, "ts": "2023-07-06 05:55:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12788"}, "ts": "2023-07-06 05:55:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12788", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:55:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32766"}, "ts": "2023-07-06 05:56:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35226", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:56:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55347", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:57:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10551832", "type": "PubMed"}, "ts": "2023-07-06 05:58:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10551832", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 05:58:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P18564.419.419"}, "ts": "2023-07-06 05:58:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18564", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 05:58:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:58:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13936", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:58:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13936"}, "ts": "2023-07-06 05:58:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34374322", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 05:59:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34374322", "type": "PubMed"}, "ts": "2023-07-06 05:59:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T6X5"}, "ts": "2023-07-06 05:59:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZT9"}, "ts": "2023-07-06 05:59:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23815289", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 05:59:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23815289", "type": "PubMed"}, "ts": "2023-07-06 05:59:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HCD6.513.513"}, "ts": "2023-07-06 05:59:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCD6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 05:59:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36896", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:59:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36896"}, "ts": "2023-07-06 05:59:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZT9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:59:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03137", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:59:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:59:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03137"}, "ts": "2023-07-06 05:59:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11229-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 05:59:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11229-1"}, "ts": "2023-07-06 05:59:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 05:59:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-06 05:59:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33051750", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 05:59:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33051750", "type": "PubMed"}, "ts": "2023-07-06 05:59:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33051750", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 05:59:57 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-06 06:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-06 06:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 06:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-06 06:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-06 06:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-06 06:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 06:00:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30899004", "type": "PubMed"}, "ts": "2023-07-06 06:00:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30899004", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 06:00:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00406II"}, "ts": "2023-07-06 06:00:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02315DX"}, "ts": "2023-07-06 06:00:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03382KH"}, "ts": "2023-07-06 06:00:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-06 06:00:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-06 06:00:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08110WX"}, "ts": "2023-07-06 06:00:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10039CR"}, "ts": "2023-07-06 06:00:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10256JP"}, "ts": "2023-07-06 06:00:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10773YW"}, "ts": "2023-07-06 06:00:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11870QZ"}, "ts": "2023-07-06 06:00:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11911BT"}, "ts": "2023-07-06 06:00:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12793SR"}, "ts": "2023-07-06 06:00:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14260UH"}, "ts": "2023-07-06 06:00:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14669DU"}, "ts": "2023-07-06 06:00:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14994KB"}, "ts": "2023-07-06 06:00:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20425TQ"}, "ts": "2023-07-06 06:00:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22276PO"}, "ts": "2023-07-06 06:00:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-06 06:00:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22355FZ"}, "ts": "2023-07-06 06:00:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50045TK"}, "ts": "2023-07-06 06:00:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-06 06:00:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-06 06:00:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25637MV"}, "ts": "2023-07-06 06:00:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74430RZ"}, "ts": "2023-07-06 06:00:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48584BU"}, "ts": "2023-07-06 06:00:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58596DI"}, "ts": "2023-07-06 06:00:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7519613", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 06:00:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7519613", "type": "PubMed"}, "ts": "2023-07-06 06:00:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:00:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q68EA5.223.223"}, "ts": "2023-07-06 06:00:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68EA5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:00:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14B71", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:00:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14B71"}, "ts": "2023-07-06 06:01:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IUI8"}, "ts": "2023-07-06 06:01:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IUI8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:01:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:01:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00747", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:01:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P00747.371.371"}, "ts": "2023-07-06 06:01:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NSD9.21.21"}, "ts": "2023-07-06 06:01:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NSD9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:01:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G83161QT"}, "ts": "2023-07-06 06:02:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:03:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JSH3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:03:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JSH3"}, "ts": "2023-07-06 06:03:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JWY8"}, "ts": "2023-07-06 06:03:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JWY8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:03:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P69905", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:03:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G26039ES", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 06:04:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G26039ES"}, "ts": "2023-07-06 06:04:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01139"}, "ts": "2023-07-06 06:04:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-06 06:04:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5SVS4"}, "ts": "2023-07-06 06:04:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:04:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SVS4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:04:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9D906.427.427"}, "ts": "2023-07-06 06:04:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D906", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:04:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "CanX", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-06 06:04:55 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "CanX"}, "ts": "2023-07-06 06:04:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 06:04:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "CanX", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=CanX"}, "ts": "2023-07-06 06:04:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 06:04:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3316406ad47bf6bd663cf46fdfdbe4c2", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 06:05:00 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "3316406ad47bf6bd663cf46fdfdbe4c2", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 06:05:00 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 06:05:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30153-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:05:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35564-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:05:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35564-1"}, "ts": "2023-07-06 06:05:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00734"}, "ts": "2023-07-06 06:05:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19096"}, "ts": "2023-07-06 06:05:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33419968", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 06:05:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33419968", "type": "PubMed"}, "ts": "2023-07-06 06:06:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33419968", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 06:06:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:06:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03519"}, "ts": "2023-07-06 06:06:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03519", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:06:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35632", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:06:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68FY0"}, "ts": "2023-07-06 06:07:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68FY0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:07:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 06:07:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PP8"}, "ts": "2023-07-06 06:07:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PP8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 06:07:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23919"}, "ts": "2023-07-06 06:08:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:08:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43561", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:08:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43561"}, "ts": "2023-07-06 06:08:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64870DN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 06:08:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64870DN"}, "ts": "2023-07-06 06:08:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04070", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:08:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13300LP"}, "ts": "2023-07-06 06:08:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "ni4l0nwi4feggvl7fzr0pin68gxb1juk", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 06:09:43 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 06:09:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "ni4l0nwi4feggvl7fzr0pin68gxb1juk", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 06:09:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56477"}, "ts": "2023-07-06 06:10:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56477", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 06:10:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18832721", "type": "PubMed"}, "ts": "2023-07-06 06:10:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18832721", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 06:10:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 06:10:51 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 06:10:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 06:10:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01100"}, "ts": "2023-07-06 06:10:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96MT3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:11:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96MT3.179.179"}, "ts": "2023-07-06 06:11:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 06:11:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G47517CO"}, "ts": "2023-07-06 06:11:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G47517CO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 06:11:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32766", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:12:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61983", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:14:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61983"}, "ts": "2023-07-06 06:14:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08188.376.376"}, "ts": "2023-07-06 06:14:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08188", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:14:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78333", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:14:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P78333.80.80"}, "ts": "2023-07-06 06:14:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NVI1"}, "ts": "2023-07-06 06:14:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVI1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:14:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08195"}, "ts": "2023-07-06 06:15:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XIF9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:15:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XIF9"}, "ts": "2023-07-06 06:15:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:15:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9GZY8.172.172"}, "ts": "2023-07-06 06:15:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZY8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:15:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15021LG"}, "ts": "2023-07-06 06:16:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15439.891.891"}, "ts": "2023-07-06 06:16:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15439", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:16:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZYF2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:17:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZYF2"}, "ts": "2023-07-06 06:17:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P58366-1"}, "ts": "2023-07-06 06:17:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58366-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:17:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZPD9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:17:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZPD9.286.286"}, "ts": "2023-07-06 06:17:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G83161QT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 06:18:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9GZY8.200.200"}, "ts": "2023-07-06 06:18:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N5N7"}, "ts": "2023-07-06 06:19:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N5N7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:19:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CQJ1"}, "ts": "2023-07-06 06:20:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CQJ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:20:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BI69"}, "ts": "2023-07-06 06:20:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BI69", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:20:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01139", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:20:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15331635", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 06:20:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15331635", "type": "PubMed"}, "ts": "2023-07-06 06:20:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12923", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:20:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12923.1923.1923"}, "ts": "2023-07-06 06:20:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00734", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:21:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19096", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:21:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10599"}, "ts": "2023-07-06 06:21:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P34972.22.22"}, "ts": "2023-07-06 06:21:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34972", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:21:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWA0"}, "ts": "2023-07-06 06:21:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:21:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13822", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:22:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13822.703.703"}, "ts": "2023-07-06 06:22:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60237"}, "ts": "2023-07-06 06:22:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q2M2I8.533.533"}, "ts": "2023-07-06 06:23:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2M2I8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:23:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWA0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:23:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14625"}, "ts": "2023-07-06 06:23:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6MG01", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 06:23:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6MG01"}, "ts": "2023-07-06 06:23:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6MG01", "user": "Undecided", "type": "error", "page": "protVista", "message": "Network error. ProtVista Detail api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 06:23:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23919", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:23:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R4U0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:25:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8R4U0.626.626"}, "ts": "2023-07-06 06:25:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75330", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 06:25:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75330"}, "ts": "2023-07-06 06:25:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08575.421.421"}, "ts": "2023-07-06 06:25:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08575", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:25:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62424"}, "ts": "2023-07-06 06:26:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33993-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:26:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33993-1"}, "ts": "2023-07-06 06:26:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12876326", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 06:26:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12876326", "type": "PubMed"}, "ts": "2023-07-06 06:26:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01100", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:26:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55006", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 06:27:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39578OU"}, "ts": "2023-07-06 06:27:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55006"}, "ts": "2023-07-06 06:27:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQW5"}, "ts": "2023-07-06 06:27:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQW5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:27:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64581RP"}, "ts": "2023-07-06 06:27:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PY5"}, "ts": "2023-07-06 06:28:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PY5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 06:28:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PGN9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:29:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PGN9"}, "ts": "2023-07-06 06:29:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 06:29:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08469"}, "ts": "2023-07-06 06:29:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08469", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 06:29:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10922056", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 06:29:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10922056", "type": "PubMed"}, "ts": "2023-07-06 06:29:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99583"}, "ts": "2023-07-06 06:30:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99583", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:30:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:30:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09104-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:30:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09104-1"}, "ts": "2023-07-06 06:30:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13308", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 06:31:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13308"}, "ts": "2023-07-06 06:31:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BPA8"}, "ts": "2023-07-06 06:31:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BPA8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 06:31:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08195", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:31:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05315", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 06:31:45 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q05315", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 06:31:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05315", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 06:31:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00451-1"}, "ts": "2023-07-06 06:31:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66HG3-1"}, "ts": "2023-07-06 06:31:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66HG3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:32:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09619.437.437"}, "ts": "2023-07-06 06:32:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09619", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:32:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15178"}, "ts": "2023-07-06 06:32:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15021LG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 06:32:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21769", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:32:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21769"}, "ts": "2023-07-06 06:32:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32507", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:32:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32507"}, "ts": "2023-07-06 06:32:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R1S4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:33:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8R1S4.262.262"}, "ts": "2023-07-06 06:33:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56715", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:33:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P56715.722.722"}, "ts": "2023-07-06 06:33:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15941", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:33:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15941"}, "ts": "2023-07-06 06:33:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60568", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:33:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60568"}, "ts": "2023-07-06 06:33:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15407YE"}, "ts": "2023-07-06 06:34:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4207120", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 06:34:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "4207120", "type": "PubMed"}, "ts": "2023-07-06 06:34:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BYI8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:35:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BYI8-1"}, "ts": "2023-07-06 06:35:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A140T8M9-1"}, "ts": "2023-07-06 06:36:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A140T8M9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:36:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R671"}, "ts": "2023-07-06 06:36:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R671", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 06:36:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R671", "user": "Undecided", "type": "error", "page": "protVista", "message": "Network error. ProtVista Detail api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 06:36:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X29", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:36:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86X29.397.397"}, "ts": "2023-07-06 06:36:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULD9"}, "ts": "2023-07-06 06:37:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:37:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10599", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:37:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZC97", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 06:37:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZC97"}, "ts": "2023-07-06 06:37:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99538"}, "ts": "2023-07-06 06:38:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99538", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:38:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VZK9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:38:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VZK9-1"}, "ts": "2023-07-06 06:38:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60237", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:38:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BJM8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:38:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BJM8-1"}, "ts": "2023-07-06 06:38:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G47748JZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 06:38:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 06:38:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25331951", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 06:38:58 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G47748JZ"}, "ts": "2023-07-06 06:38:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25331951", "type": "PubMed"}, "ts": "2023-07-06 06:38:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14625", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:39:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17290000", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 06:40:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17290000", "type": "PubMed"}, "ts": "2023-07-06 06:40:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P2E3"}, "ts": "2023-07-06 06:40:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2E3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:40:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10524236", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 06:40:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10524236", "type": "PubMed"}, "ts": "2023-07-06 06:40:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52785", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:40:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52785"}, "ts": "2023-07-06 06:40:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05371"}, "ts": "2023-07-06 06:41:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05371", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:41:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QWT9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:41:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QWT9-1"}, "ts": "2023-07-06 06:41:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23298-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:41:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23298-1"}, "ts": "2023-07-06 06:41:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29459"}, "ts": "2023-07-06 06:41:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A8MUP6"}, "ts": "2023-07-06 06:42:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8MUP6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:42:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62424", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:42:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14562029", "type": "PubMed"}, "ts": "2023-07-06 06:42:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14562029", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 06:42:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P28906.346.346"}, "ts": "2023-07-06 06:42:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28906", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:42:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07948", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:43:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07948"}, "ts": "2023-07-06 06:43:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14506234", "type": "PubMed"}, "ts": "2023-07-06 06:43:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14506234", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 06:43:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVJ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:43:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NVJ2"}, "ts": "2023-07-06 06:43:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TEB9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:43:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TEB9-1"}, "ts": "2023-07-06 06:43:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64581RP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 06:43:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7M750", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:43:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7M750"}, "ts": "2023-07-06 06:43:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34545025", "type": "PubMed"}, "ts": "2023-07-06 06:44:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34545025", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 06:44:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34545025", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 06:44:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06731-1"}, "ts": "2023-07-06 06:45:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXT6"}, "ts": "2023-07-06 06:45:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXT6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:45:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94910.996.996"}, "ts": "2023-07-06 06:45:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94910", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:45:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06493-1"}, "ts": "2023-07-06 06:45:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15031"}, "ts": "2023-07-06 06:46:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25225291", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 06:46:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25225291", "type": "PubMed"}, "ts": "2023-07-06 06:46:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60899-1"}, "ts": "2023-07-06 06:46:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q62839.37.37"}, "ts": "2023-07-06 06:46:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62839", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:46:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60899-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:46:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G55298KW"}, "ts": "2023-07-06 06:47:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 06:47:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G55298KW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 06:47:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55298KW"}, "ts": "2023-07-06 06:47:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-06 06:47:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000005"}, "ts": "2023-07-06 06:47:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92050GC"}, "ts": "2023-07-06 06:47:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42368WD"}, "ts": "2023-07-06 06:47:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12530CV"}, "ts": "2023-07-06 06:47:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R3P8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:47:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R3P8"}, "ts": "2023-07-06 06:47:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63207"}, "ts": "2023-07-06 06:47:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63207", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 06:47:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00451-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:47:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15178", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:48:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96IY4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:48:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96IY4.75.75"}, "ts": "2023-07-06 06:48:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BTE6.12.12"}, "ts": "2023-07-06 06:48:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BTE6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:48:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UL63", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:48:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UL63"}, "ts": "2023-07-06 06:48:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27931", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 06:48:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27931"}, "ts": "2023-07-06 06:48:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20219474", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 06:49:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20219474", "type": "PubMed"}, "ts": "2023-07-06 06:49:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30835"}, "ts": "2023-07-06 06:49:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06330"}, "ts": "2023-07-06 06:49:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P52655.280.280"}, "ts": "2023-07-06 06:49:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52655", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:49:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13308", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:50:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13308"}, "ts": "2023-07-06 06:50:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22579288", "type": "PubMed"}, "ts": "2023-07-06 06:50:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22579288", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 06:50:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18469862", "type": "PubMed"}, "ts": "2023-07-06 06:50:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18469862", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 06:50:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRM0"}, "ts": "2023-07-06 06:50:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15407YE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 06:50:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08AF3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:50:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08AF3"}, "ts": "2023-07-06 06:50:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08590"}, "ts": "2023-07-06 06:50:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15379"}, "ts": "2023-07-06 06:51:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12145319", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 06:51:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12145319", "type": "PubMed"}, "ts": "2023-07-06 06:51:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61457", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:51:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P61457.104.104"}, "ts": "2023-07-06 06:51:36 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G70323CJ"}, "ts": "2023-07-06 06:51:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36896"}, "ts": "2023-07-06 06:51:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36896", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:51:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11784863", "type": "PubMed"}, "ts": "2023-07-06 06:52:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11784863", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 06:52:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:52:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54843-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:52:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54843-1"}, "ts": "2023-07-06 06:52:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51654", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:52:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51654.151.151"}, "ts": "2023-07-06 06:52:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32239", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:52:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P32239.422.422"}, "ts": "2023-07-06 06:52:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2EG98"}, "ts": "2023-07-06 06:53:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98158"}, "ts": "2023-07-06 06:53:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98158", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:53:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2EG98", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:53:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WU66"}, "ts": "2023-07-06 06:53:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WU66", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:53:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CX2"}, "ts": "2023-07-06 06:53:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CX2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:53:58 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P28653-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 06:54:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9389645", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 06:54:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9389645", "type": "PubMed"}, "ts": "2023-07-06 06:54:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29508"}, "ts": "2023-07-06 06:54:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZT21", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:54:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZT21"}, "ts": "2023-07-06 06:54:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15661", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:54:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15661.254.254"}, "ts": "2023-07-06 06:54:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 06:54:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPB9", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 06:54:36 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9NPB9", "cluster_type": "unselected"}, "ts": "2023-07-06 06:54:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPB9", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 06:54:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12574869", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 06:54:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12574869", "type": "PubMed"}, "ts": "2023-07-06 06:54:59 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 06:55:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-06 06:55:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07954-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:56:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q07954-1.3839.3839"}, "ts": "2023-07-06 06:56:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z8I9"}, "ts": "2023-07-06 06:56:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z8I9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:56:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99JF8.106.106"}, "ts": "2023-07-06 06:56:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99JF8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 06:56:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60664"}, "ts": "2023-07-06 06:57:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:57:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00747", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:57:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00747"}, "ts": "2023-07-06 06:57:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29459", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:57:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-06 06:57:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33791AF"}, "ts": "2023-07-06 06:57:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-06 06:57:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-06 06:57:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-06 06:57:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53434XO"}, "ts": "2023-07-06 06:57:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01614ZM"}, "ts": "2023-07-06 06:57:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-06 06:57:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65562ZE"}, "ts": "2023-07-06 06:57:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74722FL"}, "ts": "2023-07-06 06:57:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-06 06:57:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-06 06:57:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11041DA"}, "ts": "2023-07-06 06:57:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-06 06:57:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36191CD"}, "ts": "2023-07-06 06:57:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:58:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22413"}, "ts": "2023-07-06 06:58:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22413", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:58:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8ND23", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 06:58:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8ND23"}, "ts": "2023-07-06 06:58:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41968", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 06:59:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41968"}, "ts": "2023-07-06 06:59:43 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-06 07:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-06 07:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 07:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-06 07:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-06 07:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-06 07:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A5PKW4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 07:00:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A5PKW4"}, "ts": "2023-07-06 07:00:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O55239", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 07:00:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O55239"}, "ts": "2023-07-06 07:00:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBN4"}, "ts": "2023-07-06 07:00:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBN4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:00:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z6Z7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:00:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z6Z7.30.30"}, "ts": "2023-07-06 07:00:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8K2U0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:00:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A8K2U0.595.595"}, "ts": "2023-07-06 07:00:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06731-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:00:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08582-1"}, "ts": "2023-07-06 07:01:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08582-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:01:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:01:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UP95"}, "ts": "2023-07-06 07:01:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UP95", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:01:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24030830", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 07:01:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24030830", "type": "PubMed"}, "ts": "2023-07-06 07:01:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06493-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:01:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B1H299-1"}, "ts": "2023-07-06 07:01:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1H299-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:02:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JKT9"}, "ts": "2023-07-06 07:02:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JKT9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 07:02:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11229", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:02:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11229.95.95"}, "ts": "2023-07-06 07:02:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WW12", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:02:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WW12"}, "ts": "2023-07-06 07:03:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:03:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09619", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:03:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09619.562.562"}, "ts": "2023-07-06 07:03:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35558.597.597"}, "ts": "2023-07-06 07:04:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35558", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:04:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42226"}, "ts": "2023-07-06 07:05:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35663"}, "ts": "2023-07-06 07:05:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95573"}, "ts": "2023-07-06 07:05:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75795", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 07:06:01 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O75795", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 07:06:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55287.302.302"}, "ts": "2023-07-06 07:06:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55287", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:06:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16849", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:06:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16849.245.245"}, "ts": "2023-07-06 07:06:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61999-1"}, "ts": "2023-07-06 07:06:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61999-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:06:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32418"}, "ts": "2023-07-06 07:06:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15379", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:06:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08590", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:06:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09666", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:07:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q09666.1184.1184"}, "ts": "2023-07-06 07:07:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G70323CJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 07:07:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9315851", "type": "PubMed"}, "ts": "2023-07-06 07:07:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9315851", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 07:07:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25108", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 07:07:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25108"}, "ts": "2023-07-06 07:07:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXS6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:08:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:08:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04187"}, "ts": "2023-07-06 07:08:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:08:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXS6"}, "ts": "2023-07-06 07:08:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04187", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:08:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01127"}, "ts": "2023-07-06 07:08:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26323318", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 07:08:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26323318", "type": "PubMed"}, "ts": "2023-07-06 07:08:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZH0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:08:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZH0"}, "ts": "2023-07-06 07:08:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PRD1"}, "ts": "2023-07-06 07:08:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PRD1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:08:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48735"}, "ts": "2023-07-06 07:08:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CR26", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 07:10:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CR26"}, "ts": "2023-07-06 07:10:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04727", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:10:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q04727.20.20"}, "ts": "2023-07-06 07:10:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29508", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:10:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35663", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:10:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P60468.14.14"}, "ts": "2023-07-06 07:11:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60468", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:11:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 07:11:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G78961SJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 07:11:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G78961SJ"}, "ts": "2023-07-06 07:11:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48453"}, "ts": "2023-07-06 07:11:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48453", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 07:11:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NA29.230.230"}, "ts": "2023-07-06 07:11:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXP2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:11:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NA29", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:11:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXP2"}, "ts": "2023-07-06 07:11:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NA29.240.240"}, "ts": "2023-07-06 07:11:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NA29", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:11:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52875-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:11:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52875-1"}, "ts": "2023-07-06 07:11:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVJ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:12:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IVJ1"}, "ts": "2023-07-06 07:12:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96Q89-1.1644.1644"}, "ts": "2023-07-06 07:12:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60664", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:13:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96Q89-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:13:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969I6"}, "ts": "2023-07-06 07:13:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969I6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:13:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 07:13:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9427644", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 07:13:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9427644", "type": "PubMed"}, "ts": "2023-07-06 07:13:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17694067", "type": "PubMed"}, "ts": "2023-07-06 07:13:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17694067", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 07:13:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43451", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:14:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43451"}, "ts": "2023-07-06 07:14:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04671"}, "ts": "2023-07-06 07:15:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04671", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:15:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51575", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:15:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51575.292.292"}, "ts": "2023-07-06 07:15:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12829", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:16:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12829.264.264"}, "ts": "2023-07-06 07:16:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41250-1"}, "ts": "2023-07-06 07:16:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:17:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGI6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:17:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22518138", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 07:17:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22518138", "type": "PubMed"}, "ts": "2023-07-06 07:17:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14190"}, "ts": "2023-07-06 07:18:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14190", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:18:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1G3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:18:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z1G3"}, "ts": "2023-07-06 07:18:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17912957", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 07:18:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17912957", "type": "PubMed"}, "ts": "2023-07-06 07:18:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-06 07:19:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34288098", "type": "PubMed"}, "ts": "2023-07-06 07:19:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34288098", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 07:19:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34288098", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 07:19:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NH11", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:20:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NH11"}, "ts": "2023-07-06 07:20:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15418", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:20:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15418"}, "ts": "2023-07-06 07:20:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2M3G0"}, "ts": "2023-07-06 07:20:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2M3G0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:20:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96LB8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:21:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96LB8"}, "ts": "2023-07-06 07:21:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42226", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:21:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95573", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:21:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:21:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96DN2.775.775"}, "ts": "2023-07-06 07:21:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96DN2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:21:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04235"}, "ts": "2023-07-06 07:21:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04235", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:21:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64253", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:21:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64253"}, "ts": "2023-07-06 07:21:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00213"}, "ts": "2023-07-06 07:22:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00213", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:22:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32418", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:22:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZL4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:22:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P1M3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:23:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6P1M3.634.634"}, "ts": "2023-07-06 07:23:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54762", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:23:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54762"}, "ts": "2023-07-06 07:23:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43823"}, "ts": "2023-07-06 07:23:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43823", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:23:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00754"}, "ts": "2023-07-06 07:23:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00754", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:23:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZLZ1-1"}, "ts": "2023-07-06 07:23:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZLZ1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:24:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IUQ4"}, "ts": "2023-07-06 07:24:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IUQ4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 07:24:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48735", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:24:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62386"}, "ts": "2023-07-06 07:24:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JJV4"}, "ts": "2023-07-06 07:24:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JJV4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 07:24:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 07:25:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G47579ND"}, "ts": "2023-07-06 07:25:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G47579ND", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 07:25:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZY07", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:25:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZY07"}, "ts": "2023-07-06 07:25:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BSA4"}, "ts": "2023-07-06 07:26:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BSA4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:27:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000099"}, "ts": "2023-07-06 07:27:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19889979", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 07:27:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19889979", "type": "PubMed"}, "ts": "2023-07-06 07:27:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32961270", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 07:27:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32961270", "type": "PubMed"}, "ts": "2023-07-06 07:27:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01138"}, "ts": "2023-07-06 07:27:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01138", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:27:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6KF10"}, "ts": "2023-07-06 07:28:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6KF10", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 07:28:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02768"}, "ts": "2023-07-06 07:29:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BU40"}, "ts": "2023-07-06 07:30:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BU40", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:30:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43169-1"}, "ts": "2023-07-06 07:30:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43169-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:30:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BSE2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:30:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BSE2.266.266"}, "ts": "2023-07-06 07:30:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09132", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:31:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09132"}, "ts": "2023-07-06 07:31:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q32MD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:31:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q32MD9"}, "ts": "2023-07-06 07:31:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16100574", "type": "PubMed"}, "ts": "2023-07-06 07:32:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16100574", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 07:32:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 07:33:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VE08", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 07:33:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VE08"}, "ts": "2023-07-06 07:33:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05107"}, "ts": "2023-07-06 07:33:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:33:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05107", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:33:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-06 07:34:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-06 07:34:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-06 07:34:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11870QZ"}, "ts": "2023-07-06 07:34:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23294PN"}, "ts": "2023-07-06 07:34:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-06 07:34:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72735IY"}, "ts": "2023-07-06 07:34:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 07:34:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00175"}, "ts": "2023-07-06 07:34:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00175", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:34:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:35:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14498", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:35:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14498"}, "ts": "2023-07-06 07:35:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64870DN"}, "ts": "2023-07-06 07:35:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64870DN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 07:35:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G43417UB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 07:35:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWF1"}, "ts": "2023-07-06 07:35:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWF1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:35:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68DV7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:36:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IYT1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:36:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IYT1.289.289"}, "ts": "2023-07-06 07:36:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IX05"}, "ts": "2023-07-06 07:37:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IX05", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:37:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZV73"}, "ts": "2023-07-06 07:37:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZV73", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:37:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P12036.532.532"}, "ts": "2023-07-06 07:38:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12036", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:38:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZQ7"}, "ts": "2023-07-06 07:38:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7558035", "type": "PubMed"}, "ts": "2023-07-06 07:38:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7558035", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 07:38:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UH65", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:38:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UH65"}, "ts": "2023-07-06 07:38:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UM54", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:38:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UM54"}, "ts": "2023-07-06 07:38:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12814", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:38:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14893"}, "ts": "2023-07-06 07:38:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14893", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:38:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P12814.642.642"}, "ts": "2023-07-06 07:38:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZP15", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 07:39:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZP15"}, "ts": "2023-07-06 07:39:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88312", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:40:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88312"}, "ts": "2023-07-06 07:40:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z0V8-1"}, "ts": "2023-07-06 07:40:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z0V8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:40:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99PS8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:40:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99PS8.330.330"}, "ts": "2023-07-06 07:40:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BK65"}, "ts": "2023-07-06 07:40:32 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P52747", "cluster_type": "unselected"}, "ts": "2023-07-06 07:40:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52747", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 07:40:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BK65", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:40:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00268.537.537"}, "ts": "2023-07-06 07:40:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00268", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:40:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62386", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:40:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21127204", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 07:41:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21127204", "type": "PubMed"}, "ts": "2023-07-06 07:41:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UY11"}, "ts": "2023-07-06 07:41:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95800"}, "ts": "2023-07-06 07:41:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95800", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:41:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZEK7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:42:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZEK7"}, "ts": "2023-07-06 07:42:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJZ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:42:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJZ1"}, "ts": "2023-07-06 07:42:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N122"}, "ts": "2023-07-06 07:42:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N122", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:42:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRR3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 07:42:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRR3"}, "ts": "2023-07-06 07:42:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 07:42:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48065"}, "ts": "2023-07-06 07:42:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48065", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 07:42:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35363"}, "ts": "2023-07-06 07:43:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95486", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:43:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95486.811.811"}, "ts": "2023-07-06 07:43:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 07:44:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 07:44:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24715453", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 07:44:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24715453", "type": "PubMed"}, "ts": "2023-07-06 07:44:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32092778", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 07:44:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32092778", "type": "PubMed"}, "ts": "2023-07-06 07:44:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34231059", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 07:44:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34231059", "type": "PubMed"}, "ts": "2023-07-06 07:44:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HD15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:44:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HD15"}, "ts": "2023-07-06 07:44:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R164"}, "ts": "2023-07-06 07:45:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:45:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R164", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:45:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 07:45:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07711"}, "ts": "2023-07-06 07:45:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02768", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:45:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZN17", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:46:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZN17.203.203"}, "ts": "2023-07-06 07:46:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64319-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:46:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64319-1"}, "ts": "2023-07-06 07:46:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A8MYX2"}, "ts": "2023-07-06 07:46:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4F5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:46:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8MYX2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:46:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4F5"}, "ts": "2023-07-06 07:46:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42227"}, "ts": "2023-07-06 07:46:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CV9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:46:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CV9"}, "ts": "2023-07-06 07:46:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75335", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:46:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32969", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:46:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32969"}, "ts": "2023-07-06 07:46:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75335"}, "ts": "2023-07-06 07:47:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30904", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:47:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30904"}, "ts": "2023-07-06 07:47:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75937", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:47:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75937"}, "ts": "2023-07-06 07:47:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CQX5"}, "ts": "2023-07-06 07:47:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CQX5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:47:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92997", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:48:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92997"}, "ts": "2023-07-06 07:48:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HCN3"}, "ts": "2023-07-06 07:48:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCN3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:48:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02461", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:48:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02461"}, "ts": "2023-07-06 07:48:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64449", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 07:48:39 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q64449", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 07:48:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32970"}, "ts": "2023-07-06 07:48:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z739", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:49:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z739"}, "ts": "2023-07-06 07:49:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60934"}, "ts": "2023-07-06 07:49:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60934", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:49:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JIP0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:49:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80TS3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:49:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q80TS3.911.911"}, "ts": "2023-07-06 07:49:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R118-1"}, "ts": "2023-07-06 07:50:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R118-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:50:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16070"}, "ts": "2023-07-06 07:50:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZT9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:51:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9GZT9.38.38"}, "ts": "2023-07-06 07:51:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UP23", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:51:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UP23"}, "ts": "2023-07-06 07:51:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BQ52"}, "ts": "2023-07-06 07:51:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BQ52", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:52:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13546"}, "ts": "2023-07-06 07:52:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14161", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:52:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:52:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14161"}, "ts": "2023-07-06 07:52:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49238"}, "ts": "2023-07-06 07:52:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBU2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:52:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UBU2.171.171"}, "ts": "2023-07-06 07:52:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29803", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:52:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P29803.146.146"}, "ts": "2023-07-06 07:52:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G01417SR"}, "ts": "2023-07-06 07:52:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G01417SR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 07:52:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:52:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00303-1"}, "ts": "2023-07-06 07:52:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00303-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:52:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PEZ8"}, "ts": "2023-07-06 07:52:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PEZ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:52:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32322062", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 07:52:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32322062", "type": "PubMed"}, "ts": "2023-07-06 07:53:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18938DW"}, "ts": "2023-07-06 07:53:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60899-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:53:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60899-1"}, "ts": "2023-07-06 07:53:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16150", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:53:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16150"}, "ts": "2023-07-06 07:53:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFR9"}, "ts": "2023-07-06 07:54:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFR9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:54:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04798", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:54:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04798"}, "ts": "2023-07-06 07:54:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2KHR3-1"}, "ts": "2023-07-06 07:55:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2KHR3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:55:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "2022629"}, "ts": "2023-07-06 07:55:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 07:55:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 07:55:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14573", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:55:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14573"}, "ts": "2023-07-06 07:55:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BTV4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:55:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BTV4"}, "ts": "2023-07-06 07:55:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D6R9N7-1"}, "ts": "2023-07-06 07:56:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D6R9N7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:56:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A597", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:57:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2G4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:57:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H2G4.20.20"}, "ts": "2023-07-06 07:57:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29144"}, "ts": "2023-07-06 07:57:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92793"}, "ts": "2023-07-06 07:58:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92793", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:58:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12983"}, "ts": "2023-07-06 07:58:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12983", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:58:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68CZ2"}, "ts": "2023-07-06 07:58:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68CZ2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 07:58:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10515", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:58:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10515"}, "ts": "2023-07-06 07:58:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q687X5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 07:58:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q687X5.323.323"}, "ts": "2023-07-06 07:58:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31949"}, "ts": "2023-07-06 07:59:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15061"}, "ts": "2023-07-06 07:59:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18507"}, "ts": "2023-07-06 07:59:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18507", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 07:59:55 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-06 08:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-06 08:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 08:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-06 08:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-06 08:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-06 08:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01113", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:00:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q01113.331.331"}, "ts": "2023-07-06 08:00:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75829", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:00:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75829"}, "ts": "2023-07-06 08:00:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92530", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:00:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92530"}, "ts": "2023-07-06 08:00:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6URK8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:00:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6URK8.105.105"}, "ts": "2023-07-06 08:00:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G40576JC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 08:01:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G40576JC"}, "ts": "2023-07-06 08:01:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15047", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:02:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15047.915.915"}, "ts": "2023-07-06 08:02:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16070", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 08:02:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16070"}, "ts": "2023-07-06 08:02:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42227", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:02:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12268"}, "ts": "2023-07-06 08:03:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12268", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:03:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:03:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HBU6.107.107"}, "ts": "2023-07-06 08:03:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBU6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:03:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A183", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:03:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A183"}, "ts": "2023-07-06 08:03:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13638-1"}, "ts": "2023-07-06 08:03:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14964", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:03:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14964.390.390"}, "ts": "2023-07-06 08:03:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86X55"}, "ts": "2023-07-06 08:03:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X55", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:03:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V877", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:03:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V877"}, "ts": "2023-07-06 08:03:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91X17", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:04:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91X17"}, "ts": "2023-07-06 08:04:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04759", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:04:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04759"}, "ts": "2023-07-06 08:04:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z4F1"}, "ts": "2023-07-06 08:04:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z4F1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:04:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:04:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YB7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:05:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86YB7-1"}, "ts": "2023-07-06 08:05:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15800-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 08:05:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z5J1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 08:05:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15800-1"}, "ts": "2023-07-06 08:05:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z5J1"}, "ts": "2023-07-06 08:05:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94986"}, "ts": "2023-07-06 08:05:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94986", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:05:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09225", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:06:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09225"}, "ts": "2023-07-06 08:06:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16070", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:06:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G23546LY"}, "ts": "2023-07-06 08:07:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12259", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:07:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P12259.1148.1148"}, "ts": "2023-07-06 08:07:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24899407", "type": "PubMed"}, "ts": "2023-07-06 08:07:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24899407", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:07:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y613"}, "ts": "2023-07-06 08:07:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y613", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:07:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:07:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 08:07:45 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 08:07:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 08:07:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13546", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:07:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75417", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:08:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75417"}, "ts": "2023-07-06 08:08:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49238", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:08:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18754", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:08:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18754"}, "ts": "2023-07-06 08:08:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35442"}, "ts": "2023-07-06 08:08:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96QH8"}, "ts": "2023-07-06 08:08:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QH8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 08:08:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01130"}, "ts": "2023-07-06 08:08:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q53TQ3-1"}, "ts": "2023-07-06 08:08:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q53TQ3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:09:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A1A5C7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:09:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A1A5C7"}, "ts": "2023-07-06 08:09:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18938DW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 08:09:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0D2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:09:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14157"}, "ts": "2023-07-06 08:09:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:10:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07492", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:10:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07492"}, "ts": "2023-07-06 08:10:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 08:10:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:11:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDM6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:11:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TDM6.1011.1011"}, "ts": "2023-07-06 08:11:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96MU5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 08:11:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96MU5"}, "ts": "2023-07-06 08:11:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29788", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:11:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29788"}, "ts": "2023-07-06 08:11:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:12:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43629"}, "ts": "2023-07-06 08:12:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43629", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:12:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00056MO"}, "ts": "2023-07-06 08:12:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00056MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 08:12:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NE22", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:12:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4V8E9", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 08:12:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NE22"}, "ts": "2023-07-06 08:12:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 08:12:20 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q4V8E9", "cluster_type": "unselected"}, "ts": "2023-07-06 08:12:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4V8E9", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 08:12:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6GQT0"}, "ts": "2023-07-06 08:12:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6GQT0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 08:12:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:13:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UEY8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:13:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UEY8"}, "ts": "2023-07-06 08:13:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 08:13:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16678"}, "ts": "2023-07-06 08:13:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16678", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:13:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60678", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:13:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60678.171.171"}, "ts": "2023-07-06 08:13:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29144", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:13:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55287.538.538"}, "ts": "2023-07-06 08:14:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55287", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:14:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31949", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:15:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60603"}, "ts": "2023-07-06 08:15:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60603", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:15:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53801", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:15:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53801"}, "ts": "2023-07-06 08:15:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15061", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:15:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86VZ5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:16:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86VZ5-1"}, "ts": "2023-07-06 08:16:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91VY9"}, "ts": "2023-07-06 08:16:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91VY9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 08:16:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P31150.445.445"}, "ts": "2023-07-06 08:16:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31150", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:16:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07358"}, "ts": "2023-07-06 08:17:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07358", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:17:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TRM8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 08:17:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3TRM8"}, "ts": "2023-07-06 08:17:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01880", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:17:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01880.227.227"}, "ts": "2023-07-06 08:17:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96K76"}, "ts": "2023-07-06 08:17:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96K76", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:17:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PP4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:18:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PP4"}, "ts": "2023-07-06 08:18:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15294"}, "ts": "2023-07-06 08:18:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1V8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:18:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H1V8.701.701"}, "ts": "2023-07-06 08:18:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04798"}, "ts": "2023-07-06 08:18:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04798", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:18:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:18:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08722.314.314"}, "ts": "2023-07-06 08:19:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08722", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:19:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96IK0"}, "ts": "2023-07-06 08:19:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96IK0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:19:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24962073", "type": "PubMed"}, "ts": "2023-07-06 08:19:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24962073", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:19:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13638-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:19:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:19:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42345", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:19:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42345"}, "ts": "2023-07-06 08:19:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12805"}, "ts": "2023-07-06 08:19:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 08:19:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:20:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "36809979", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:20:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "36809979", "type": "PubMed"}, "ts": "2023-07-06 08:20:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SSG8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:21:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5SSG8"}, "ts": "2023-07-06 08:21:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35922"}, "ts": "2023-07-06 08:22:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35922", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:22:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G23546LY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 08:23:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VDG6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 08:23:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VDG6"}, "ts": "2023-07-06 08:23:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12778-1"}, "ts": "2023-07-06 08:23:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-06 08:23:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35457"}, "ts": "2023-07-06 08:23:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35457", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:23:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35442", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:24:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TP1"}, "ts": "2023-07-06 08:24:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13018"}, "ts": "2023-07-06 08:24:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WWK9.157.157"}, "ts": "2023-07-06 08:24:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWK9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:24:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01130", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:25:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33064882", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:25:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33064882", "type": "PubMed"}, "ts": "2023-07-06 08:25:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:25:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VTE0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:25:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VTE0"}, "ts": "2023-07-06 08:25:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33064882", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 08:25:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H6X2"}, "ts": "2023-07-06 08:25:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14157", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:25:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8CBW3.428.428"}, "ts": "2023-07-06 08:25:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CBW3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:25:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01130", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:25:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21533", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:26:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21533"}, "ts": "2023-07-06 08:26:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q61554.2711.2711"}, "ts": "2023-07-06 08:27:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N7R7"}, "ts": "2023-07-06 08:27:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N7R7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:27:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61554", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:27:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1M9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:28:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z1M9"}, "ts": "2023-07-06 08:28:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P84099"}, "ts": "2023-07-06 08:31:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P84099", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 08:31:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15085", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:31:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15085.245.245"}, "ts": "2023-07-06 08:31:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TAV3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:31:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TAV3.191.191"}, "ts": "2023-07-06 08:31:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49641"}, "ts": "2023-07-06 08:32:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49641", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:32:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4FZB7"}, "ts": "2023-07-06 08:32:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4FZB7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:32:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17612", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:32:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17612"}, "ts": "2023-07-06 08:32:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23025-1"}, "ts": "2023-07-06 08:33:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23025-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:33:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00418", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:33:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08495", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:33:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00418.311.311"}, "ts": "2023-07-06 08:33:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08495.144.144"}, "ts": "2023-07-06 08:33:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15294", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:33:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12791", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:34:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12791"}, "ts": "2023-07-06 08:34:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23271734", "type": "PubMed"}, "ts": "2023-07-06 08:34:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23271734", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:34:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BVL2.141.141"}, "ts": "2023-07-06 08:34:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BVL2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:34:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:35:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7592911", "type": "PubMed"}, "ts": "2023-07-06 08:35:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7592911", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:35:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9W4C5"}, "ts": "2023-07-06 08:35:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9W4C5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:35:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12805", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:35:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NUJ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:36:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NUJ1"}, "ts": "2023-07-06 08:36:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30530", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:36:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P30530.177.177"}, "ts": "2023-07-06 08:36:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EQY0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:36:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EQY0"}, "ts": "2023-07-06 08:36:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34664305", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:36:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34664305", "type": "PubMed"}, "ts": "2023-07-06 08:36:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34664305", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 08:36:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZK5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:36:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZK5"}, "ts": "2023-07-06 08:36:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15233.365.365"}, "ts": "2023-07-06 08:36:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15233", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:36:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09871"}, "ts": "2023-07-06 08:36:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZR2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:37:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NZR2.4150.4150"}, "ts": "2023-07-06 08:37:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P39086.542.542"}, "ts": "2023-07-06 08:37:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39086", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:37:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75326.258.258"}, "ts": "2023-07-06 08:37:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75326", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:37:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32581239", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:38:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32581239", "type": "PubMed"}, "ts": "2023-07-06 08:38:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24668", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:38:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24668"}, "ts": "2023-07-06 08:38:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13873", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:38:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13873.181.181"}, "ts": "2023-07-06 08:38:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34290256", "type": "PubMed"}, "ts": "2023-07-06 08:38:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34290256", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:38:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00395TQ"}, "ts": "2023-07-06 08:38:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43121"}, "ts": "2023-07-06 08:39:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12778-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:39:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5M8"}, "ts": "2023-07-06 08:39:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5M8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:39:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z291", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:39:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z291"}, "ts": "2023-07-06 08:39:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A1Z198-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:39:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A1Z198-1"}, "ts": "2023-07-06 08:39:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13018", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:40:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16070-1"}, "ts": "2023-07-06 08:40:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:41:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94864"}, "ts": "2023-07-06 08:41:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94864", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:41:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12839", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:41:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12839"}, "ts": "2023-07-06 08:41:22 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 08:41:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 08:41:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 08:41:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZV26", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:42:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZV26"}, "ts": "2023-07-06 08:42:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "try-me", "message": "page access"}, "ts": "2023-07-06 08:42:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3030290", "type": "PubMed"}, "ts": "2023-07-06 08:42:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3030290", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:42:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92620", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:43:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92620.319.319"}, "ts": "2023-07-06 08:43:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QX74", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:43:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9QX74.1292.1292"}, "ts": "2023-07-06 08:43:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19804566", "type": "PubMed"}, "ts": "2023-07-06 08:43:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19804566", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:43:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NAC3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:43:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NAC3"}, "ts": "2023-07-06 08:43:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:44:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75506", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:44:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75506"}, "ts": "2023-07-06 08:44:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14787.661.661"}, "ts": "2023-07-06 08:44:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14787", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:44:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WU67"}, "ts": "2023-07-06 08:44:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WU67", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:44:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZS69", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:45:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZS69"}, "ts": "2023-07-06 08:45:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:45:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "1838307"}, "ts": "2023-07-06 08:45:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 08:45:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C138", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 08:45:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C138"}, "ts": "2023-07-06 08:45:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28900043", "type": "PubMed"}, "ts": "2023-07-06 08:46:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28900043", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:46:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51398", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:46:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51398.177.177"}, "ts": "2023-07-06 08:46:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "platelet", "user": "Undecided", "type": "user", "page": "try-me", "message": "Performing Global Search"}, "ts": "2023-07-06 08:46:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 08:46:56 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "platelet"}, "ts": "2023-07-06 08:46:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 08:46:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "platelet", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=platelet"}, "ts": "2023-07-06 08:46:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f60afb0af550af0eb58d3bf385fc14a7", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 08:46:59 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "f60afb0af550af0eb58d3bf385fc14a7", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 08:46:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-06 08:47:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60890ZT"}, "ts": "2023-07-06 08:47:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15169WU"}, "ts": "2023-07-06 08:47:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-06 08:47:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96921ZU"}, "ts": "2023-07-06 08:47:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16774YZ"}, "ts": "2023-07-06 08:47:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38022PE"}, "ts": "2023-07-06 08:47:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42686NQ"}, "ts": "2023-07-06 08:47:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16150CJ"}, "ts": "2023-07-06 08:47:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01614ZM"}, "ts": "2023-07-06 08:47:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JZX4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:47:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JZX4"}, "ts": "2023-07-06 08:47:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13395", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:47:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13395.1174.1174"}, "ts": "2023-07-06 08:47:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 08:47:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96921ZU"}, "ts": "2023-07-06 08:47:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96921ZU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 08:47:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-06 08:47:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000034"}, "ts": "2023-07-06 08:47:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42039FI"}, "ts": "2023-07-06 08:47:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69616RY"}, "ts": "2023-07-06 08:47:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83385WA"}, "ts": "2023-07-06 08:47:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31642403", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:47:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31642403", "type": "PubMed"}, "ts": "2023-07-06 08:47:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57724", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:47:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P57724"}, "ts": "2023-07-06 08:47:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:47:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H342"}, "ts": "2023-07-06 08:47:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H342", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:47:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01880"}, "ts": "2023-07-06 08:48:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96S94", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:48:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96S94"}, "ts": "2023-07-06 08:48:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19112"}, "ts": "2023-07-06 08:48:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19112", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 08:48:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3342888", "type": "PubMed"}, "ts": "2023-07-06 08:48:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3342888", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:48:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:48:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-06 08:48:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-06 08:48:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69834CE"}, "ts": "2023-07-06 08:48:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81006GJ"}, "ts": "2023-07-06 08:48:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96M89", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:48:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:48:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXD0"}, "ts": "2023-07-06 08:48:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXD0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:48:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96M89.516.516"}, "ts": "2023-07-06 08:48:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3571205", "type": "PubMed"}, "ts": "2023-07-06 08:48:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3571205", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:48:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:48:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11457RF"}, "ts": "2023-07-06 08:48:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12396GB"}, "ts": "2023-07-06 08:48:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24432GW"}, "ts": "2023-07-06 08:48:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46748BU"}, "ts": "2023-07-06 08:48:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65562ZE"}, "ts": "2023-07-06 08:48:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86750HK"}, "ts": "2023-07-06 08:48:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95931.143.143"}, "ts": "2023-07-06 08:49:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95931", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:49:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:49:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14258", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:49:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14258"}, "ts": "2023-07-06 08:49:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15231.447.447"}, "ts": "2023-07-06 08:49:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15231", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:49:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NTN9.55.55"}, "ts": "2023-07-06 08:49:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NTN9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:49:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WV80"}, "ts": "2023-07-06 08:49:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WV80", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 08:49:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UMX9.412.412"}, "ts": "2023-07-06 08:50:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UMX9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:50:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14859"}, "ts": "2023-07-06 08:50:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25647305", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:50:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25647305", "type": "PubMed"}, "ts": "2023-07-06 08:50:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25647305", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 08:50:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17363299", "type": "PubMed"}, "ts": "2023-07-06 08:50:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17363299", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:50:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34944046", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:50:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34944046", "type": "PubMed"}, "ts": "2023-07-06 08:50:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49641-3"}, "ts": "2023-07-06 08:51:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49641-3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:51:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZL4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:51:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZL4"}, "ts": "2023-07-06 08:51:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55072"}, "ts": "2023-07-06 08:51:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55072", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:51:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49247"}, "ts": "2023-07-06 08:51:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18510", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:52:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18510"}, "ts": "2023-07-06 08:52:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N6N7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:52:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N6N7"}, "ts": "2023-07-06 08:52:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:52:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95497", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:52:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z265"}, "ts": "2023-07-06 08:52:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z265", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:52:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19079066", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:52:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19079066", "type": "PubMed"}, "ts": "2023-07-06 08:52:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O09110"}, "ts": "2023-07-06 08:52:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O09110", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:52:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09871", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:53:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22907", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 08:53:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22907"}, "ts": "2023-07-06 08:53:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BK52", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 08:53:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BK52"}, "ts": "2023-07-06 08:53:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9736737", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:53:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9736737", "type": "PubMed"}, "ts": "2023-07-06 08:53:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NDZ0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 08:53:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NDZ0.73.73"}, "ts": "2023-07-06 08:53:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23933751", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:53:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23933751", "type": "PubMed"}, "ts": "2023-07-06 08:53:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00395TQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 08:54:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P03999", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:54:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P03999"}, "ts": "2023-07-06 08:54:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43121", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:55:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49108TO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 08:55:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G83461WR"}, "ts": "2023-07-06 08:55:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16070-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:56:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:56:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14718", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:56:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14718"}, "ts": "2023-07-06 08:56:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:57:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CBR1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 08:57:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CBR1"}, "ts": "2023-07-06 08:57:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70278", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 08:57:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70278"}, "ts": "2023-07-06 08:57:36 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G78059CC"}, "ts": "2023-07-06 08:57:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11943479", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 08:58:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 08:58:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11943479", "type": "PubMed"}, "ts": "2023-07-06 08:58:25 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 08:58:25 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 08:58:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 08:58:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 08:58:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Composition Search"}, "ts": "2023-07-06 08:59:02 EDT-0400"}, {"api": "/glycan/search/", "req": {"composition": [{"residue": "dhex", "min": 0, "max": 0}, {"residue": "hex", "min": 3, "max": 3}, {"residue": "hexnac", "min": 4, "max": 4}, {"residue": "hexa", "min": 0, "max": 0}, {"residue": "hexn", "min": 0, "max": 0}, {"residue": "neuac", "min": 0, "max": 0}, {"residue": "neugc", "min": 0, "max": 0}, {"residue": "p", "min": 0, "max": 0}, {"residue": "pent", "min": 0, "max": 0}, {"residue": "s", "min": 0, "max": 0}, {"residue": "other", "min": 0, "max": 0}]}, "ts": "2023-07-06 08:59:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">64c068c22983e67047f1daf1cad148b1", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Composition Search query={\"composition\":[{\"residue\":\"dhex\",\"min\":0,\"max\":0},{\"residue\":\"hex\",\"min\":3,\"max\":3},{\"residue\":\"hexnac\",\"min\":4,\"max\":4},{\"residue\":\"hexa\",\"min\":0,\"max\":0},{\"residue\":\"hexn\",\"min\":0,\"max\":0},{\"residue\":\"neuac\",\"min\":0,\"max\":0},{\"residue\":\"neugc\",\"min\":0,\"max\":0},{\"residue\":\"p\",\"min\":0,\"max\":0},{\"residue\":\"pent\",\"min\":0,\"max\":0},{\"residue\":\"s\",\"min\":0,\"max\":0},{\"residue\":\"other\",\"min\":0,\"max\":0}]}"}, "ts": "2023-07-06 08:59:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "64c068c22983e67047f1daf1cad148b1", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 08:59:09 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "64c068c22983e67047f1daf1cad148b1", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 08:59:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39213VZ"}, "ts": "2023-07-06 08:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42679AH"}, "ts": "2023-07-06 08:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11453BM"}, "ts": "2023-07-06 08:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32814EW"}, "ts": "2023-07-06 08:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74916CC"}, "ts": "2023-07-06 08:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30633FJ"}, "ts": "2023-07-06 08:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39943KJ"}, "ts": "2023-07-06 08:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98140IX"}, "ts": "2023-07-06 08:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50707YR"}, "ts": "2023-07-06 08:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96570OI"}, "ts": "2023-07-06 08:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53956RO"}, "ts": "2023-07-06 08:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19943KG"}, "ts": "2023-07-06 08:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10805TH"}, "ts": "2023-07-06 08:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61283FH"}, "ts": "2023-07-06 08:59:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56175ED"}, "ts": "2023-07-06 08:59:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05027SR"}, "ts": "2023-07-06 08:59:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88876JQ"}, "ts": "2023-07-06 08:59:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72108VJ"}, "ts": "2023-07-06 08:59:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30915AU"}, "ts": "2023-07-06 08:59:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04048YA"}, "ts": "2023-07-06 08:59:12 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 08:59:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 08:59:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 08:59:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G39213VZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 08:59:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G39213VZ"}, "ts": "2023-07-06 08:59:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35029YA"}, "ts": "2023-07-06 08:59:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15843XU"}, "ts": "2023-07-06 08:59:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78607HP"}, "ts": "2023-07-06 08:59:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56524-1"}, "ts": "2023-07-06 08:59:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Composition Search"}, "ts": "2023-07-06 08:59:34 EDT-0400"}, {"api": "/glycan/search/", "req": {"composition": [{"residue": "dhex", "min": 0, "max": 0}, {"residue": "hex", "min": 3, "max": 3}, {"residue": "hexnac", "min": 4, "max": 4}, {"residue": "hexa", "min": 0, "max": 0}, {"residue": "hexn", "min": 0, "max": 0}, {"residue": "neuac", "min": 0, "max": 0}, {"residue": "neugc", "min": 0, "max": 0}, {"residue": "p", "min": 0, "max": 0}, {"residue": "pent", "min": 0, "max": 0}, {"residue": "s", "min": 0, "max": 0}, {"residue": "other", "min": 0, "max": 0}]}, "ts": "2023-07-06 08:59:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96FW1"}, "ts": "2023-07-06 08:59:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">64c068c22983e67047f1daf1cad148b1", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Composition Search query={\"composition\":[{\"residue\":\"dhex\",\"min\":0,\"max\":0},{\"residue\":\"hex\",\"min\":3,\"max\":3},{\"residue\":\"hexnac\",\"min\":4,\"max\":4},{\"residue\":\"hexa\",\"min\":0,\"max\":0},{\"residue\":\"hexn\",\"min\":0,\"max\":0},{\"residue\":\"neuac\",\"min\":0,\"max\":0},{\"residue\":\"neugc\",\"min\":0,\"max\":0},{\"residue\":\"p\",\"min\":0,\"max\":0},{\"residue\":\"pent\",\"min\":0,\"max\":0},{\"residue\":\"s\",\"min\":0,\"max\":0},{\"residue\":\"other\",\"min\":0,\"max\":0}]}"}, "ts": "2023-07-06 08:59:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "64c068c22983e67047f1daf1cad148b1", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 08:59:44 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "64c068c22983e67047f1daf1cad148b1", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 08:59:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11453BM"}, "ts": "2023-07-06 08:59:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39213VZ"}, "ts": "2023-07-06 08:59:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42679AH"}, "ts": "2023-07-06 08:59:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98140IX"}, "ts": "2023-07-06 08:59:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74916CC"}, "ts": "2023-07-06 08:59:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30633FJ"}, "ts": "2023-07-06 08:59:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39943KJ"}, "ts": "2023-07-06 08:59:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32814EW"}, "ts": "2023-07-06 08:59:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50707YR"}, "ts": "2023-07-06 08:59:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96570OI"}, "ts": "2023-07-06 08:59:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53956RO"}, "ts": "2023-07-06 08:59:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19943KG"}, "ts": "2023-07-06 08:59:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10805TH"}, "ts": "2023-07-06 08:59:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61283FH"}, "ts": "2023-07-06 08:59:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56175ED"}, "ts": "2023-07-06 08:59:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05027SR"}, "ts": "2023-07-06 08:59:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88876JQ"}, "ts": "2023-07-06 08:59:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72108VJ"}, "ts": "2023-07-06 08:59:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30915AU"}, "ts": "2023-07-06 08:59:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04048YA"}, "ts": "2023-07-06 08:59:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G39213VZ"}, "ts": "2023-07-06 08:59:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G39213VZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 08:59:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15843XU"}, "ts": "2023-07-06 08:59:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35029YA"}, "ts": "2023-07-06 08:59:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78607HP"}, "ts": "2023-07-06 08:59:51 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-06 09:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-06 09:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 09:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-06 09:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-06 09:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-06 09:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T871", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:00:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5T871.42.42"}, "ts": "2023-07-06 09:00:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64240"}, "ts": "2023-07-06 09:00:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6EV70-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:00:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6EV70-1"}, "ts": "2023-07-06 09:00:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7493923", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 09:00:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7493923", "type": "PubMed"}, "ts": "2023-07-06 09:00:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGX3.296.296"}, "ts": "2023-07-06 09:01:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGX3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:01:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:02:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16558", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:02:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16558"}, "ts": "2023-07-06 09:02:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "C9JE40.530.530"}, "ts": "2023-07-06 09:03:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "C9JE40", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:03:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G30691VK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 09:03:08 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G30691VK"}, "ts": "2023-07-06 09:03:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M0Z1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 09:03:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M0Z1"}, "ts": "2023-07-06 09:03:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92734.337.337"}, "ts": "2023-07-06 09:03:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92734", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:03:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01880", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:04:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGD5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:04:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGD5"}, "ts": "2023-07-06 09:04:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20930"}, "ts": "2023-07-06 09:05:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20930", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:05:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91Y94-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:05:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91Y94-1"}, "ts": "2023-07-06 09:05:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A6NHJ4.70.70"}, "ts": "2023-07-06 09:05:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NHJ4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:05:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:05:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13576", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:06:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13576.716.716"}, "ts": "2023-07-06 09:06:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9Q7M2"}, "ts": "2023-07-06 09:06:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q7M2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 09:06:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14859", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:06:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q920E5-1"}, "ts": "2023-07-06 09:06:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q920E5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:06:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0E7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:06:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06837-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:06:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06837-1"}, "ts": "2023-07-06 09:06:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51679"}, "ts": "2023-07-06 09:07:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49247", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:08:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12830"}, "ts": "2023-07-06 09:08:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BZ39"}, "ts": "2023-07-06 09:08:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BZ39", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:08:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96K21", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:08:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96K21"}, "ts": "2023-07-06 09:08:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99459.716.716"}, "ts": "2023-07-06 09:08:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99459", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:08:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CH87", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:10:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CH87"}, "ts": "2023-07-06 09:10:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 09:10:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "6696436", "type": "PubMed"}, "ts": "2023-07-06 09:10:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6696436", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 09:10:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UVV9-1"}, "ts": "2023-07-06 09:10:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UVV9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:10:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95398-1"}, "ts": "2023-07-06 09:10:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95398-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:10:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P2S2.587.587"}, "ts": "2023-07-06 09:11:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2S2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:11:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:11:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2L1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:11:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2L1.626.626"}, "ts": "2023-07-06 09:11:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G83461WR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 09:11:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00335DM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 09:11:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00335DM"}, "ts": "2023-07-06 09:11:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4VC17"}, "ts": "2023-07-06 09:11:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4VC17", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:12:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30050", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:12:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30050"}, "ts": "2023-07-06 09:12:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10742096", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 09:12:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10742096", "type": "PubMed"}, "ts": "2023-07-06 09:12:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04351"}, "ts": "2023-07-06 09:13:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G78059CC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 09:13:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 09:14:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RJ0", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 09:14:02 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q96RJ0", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 09:14:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RJ0", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 09:14:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:14:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76093", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:14:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O76093"}, "ts": "2023-07-06 09:14:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q69YN4"}, "ts": "2023-07-06 09:14:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q69YN4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:14:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56524-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:15:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2J0"}, "ts": "2023-07-06 09:15:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WTT6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:15:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16310", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 09:15:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16310"}, "ts": "2023-07-06 09:15:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BYI6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 09:16:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BYI6"}, "ts": "2023-07-06 09:16:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXS8", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 09:16:11 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8WXS8", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 09:16:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64240", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:16:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NW07", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:17:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NW07.564.564"}, "ts": "2023-07-06 09:17:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:17:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15178", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:17:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15178"}, "ts": "2023-07-06 09:17:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17906697", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 09:17:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17906697", "type": "PubMed"}, "ts": "2023-07-06 09:17:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 09:17:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86Y22", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 09:17:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86Y22"}, "ts": "2023-07-06 09:17:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G30691VK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 09:18:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G30691VK"}, "ts": "2023-07-06 09:18:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q921V7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:18:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q921V7"}, "ts": "2023-07-06 09:18:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3U962"}, "ts": "2023-07-06 09:19:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3U962", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:19:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62840", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:19:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62840"}, "ts": "2023-07-06 09:19:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0V8T5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:19:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0V8T5"}, "ts": "2023-07-06 09:19:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z2W4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:19:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z2W4.275.275"}, "ts": "2023-07-06 09:19:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UMX0"}, "ts": "2023-07-06 09:19:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UMX0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:19:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 09:20:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30379171", "type": "PubMed"}, "ts": "2023-07-06 09:20:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30379171", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 09:20:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGK8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:20:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UGK8.271.271"}, "ts": "2023-07-06 09:20:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3V1N9"}, "ts": "2023-07-06 09:21:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3V1N9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 09:21:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60894"}, "ts": "2023-07-06 09:22:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8270621", "type": "PubMed"}, "ts": "2023-07-06 09:22:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8270621", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 09:22:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13002.102.102"}, "ts": "2023-07-06 09:22:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13002", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:22:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ESS9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 09:22:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ESS9"}, "ts": "2023-07-06 09:22:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4AC39-1"}, "ts": "2023-07-06 09:22:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4AC39-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:23:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51679", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:23:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10978331", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 09:23:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10978331", "type": "PubMed"}, "ts": "2023-07-06 09:23:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18077", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 09:23:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18077"}, "ts": "2023-07-06 09:23:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8755482", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 09:24:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8755482", "type": "PubMed"}, "ts": "2023-07-06 09:24:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35811"}, "ts": "2023-07-06 09:24:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12830", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:24:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35811", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:24:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q05066"}, "ts": "2023-07-06 09:24:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05066", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:24:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07451", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:25:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07451"}, "ts": "2023-07-06 09:25:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RB24", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 09:25:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YA3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:25:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86YA3"}, "ts": "2023-07-06 09:25:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54885", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:25:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54885"}, "ts": "2023-07-06 09:25:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RB24"}, "ts": "2023-07-06 09:25:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHI8"}, "ts": "2023-07-06 09:25:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHI8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:25:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q53ET0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:25:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q53ET0"}, "ts": "2023-07-06 09:25:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z589", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:26:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z589"}, "ts": "2023-07-06 09:26:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 09:26:34 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 09:26:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14804"}, "ts": "2023-07-06 09:26:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14804", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:26:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 09:26:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G95393JS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 09:26:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G95393JS"}, "ts": "2023-07-06 09:26:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R085"}, "ts": "2023-07-06 09:27:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R085", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:27:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-06 09:27:12 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 09:27:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 09:27:31 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "TBXT", "term_category": "any"}, "ts": "2023-07-06 09:27:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">7a69af75b94e3df7073928d550fdbbba", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"TBXT\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 09:27:31 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 09:27:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7a69af75b94e3df7073928d550fdbbba", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 09:27:32 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "7a69af75b94e3df7073928d550fdbbba", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 09:27:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7a69af75b94e3df7073928d550fdbbba", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 09:27:37 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "7a69af75b94e3df7073928d550fdbbba", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}]}, "ts": "2023-07-06 09:27:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15178-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:28:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15178-1"}, "ts": "2023-07-06 09:28:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 09:28:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P84074", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:28:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P84074"}, "ts": "2023-07-06 09:28:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G88374WZ"}, "ts": "2023-07-06 09:28:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G40702WU"}, "ts": "2023-07-06 09:29:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04351", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:29:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C000", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:29:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9C000.955.955"}, "ts": "2023-07-06 09:29:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15328-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:30:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15328-1"}, "ts": "2023-07-06 09:30:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U5Z8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:30:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5U5Z8.218.218"}, "ts": "2023-07-06 09:30:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6R2P8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:30:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6R2P8"}, "ts": "2023-07-06 09:30:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11886537", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 09:30:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11886537", "type": "PubMed"}, "ts": "2023-07-06 09:30:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86X55"}, "ts": "2023-07-06 09:30:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X55", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:30:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F7F6T0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:30:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F7F6T0"}, "ts": "2023-07-06 09:30:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZK7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:30:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZK7"}, "ts": "2023-07-06 09:30:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G29857RC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 09:30:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z449"}, "ts": "2023-07-06 09:31:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z449", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:31:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:31:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47825-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:31:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47825-1"}, "ts": "2023-07-06 09:31:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14982-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:31:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 09:31:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14982-1"}, "ts": "2023-07-06 09:32:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A4M1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:33:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A4M1"}, "ts": "2023-07-06 09:33:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62036-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:33:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62036-1"}, "ts": "2023-07-06 09:33:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11070170", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 09:34:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11070170", "type": "PubMed"}, "ts": "2023-07-06 09:34:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16783569", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 09:35:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16783569", "type": "PubMed"}, "ts": "2023-07-06 09:35:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13224", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:35:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13224.350.350"}, "ts": "2023-07-06 09:35:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H672-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:36:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H672-1"}, "ts": "2023-07-06 09:36:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q10981"}, "ts": "2023-07-06 09:36:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UKA4.1136.1136"}, "ts": "2023-07-06 09:37:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKA4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:37:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UBE0.15.15"}, "ts": "2023-07-06 09:37:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBE0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:37:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V9D0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 09:38:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V9D0"}, "ts": "2023-07-06 09:38:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y279", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:38:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60894", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:38:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y279"}, "ts": "2023-07-06 09:38:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48059"}, "ts": "2023-07-06 09:38:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48059", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:38:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:38:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60906", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 09:38:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60906"}, "ts": "2023-07-06 09:38:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q10980"}, "ts": "2023-07-06 09:39:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DN86", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:39:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P0DN86.33.33"}, "ts": "2023-07-06 09:39:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96R09", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:39:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96R09"}, "ts": "2023-07-06 09:39:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29868776", "type": "PubMed"}, "ts": "2023-07-06 09:39:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29868776", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 09:39:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BVS4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:40:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BVS4"}, "ts": "2023-07-06 09:40:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGI8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:40:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGI8"}, "ts": "2023-07-06 09:40:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZND0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:41:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZND0"}, "ts": "2023-07-06 09:41:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULN7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:41:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULN7"}, "ts": "2023-07-06 09:41:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04671"}, "ts": "2023-07-06 09:41:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZRV2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:41:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZRV2.788.788"}, "ts": "2023-07-06 09:41:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H3G5"}, "ts": "2023-07-06 09:42:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01258", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:42:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01258"}, "ts": "2023-07-06 09:42:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23333871", "type": "PubMed"}, "ts": "2023-07-06 09:42:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23333871", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 09:42:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42261"}, "ts": "2023-07-06 09:44:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42261", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:44:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G88374WZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 09:44:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G40702WU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 09:45:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48357", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:45:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P48357.659.659"}, "ts": "2023-07-06 09:46:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 09:46:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55774", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 09:46:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55774"}, "ts": "2023-07-06 09:46:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95198", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:47:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95198"}, "ts": "2023-07-06 09:47:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75943", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:47:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75943.71.71"}, "ts": "2023-07-06 09:47:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWJ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:47:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWJ2"}, "ts": "2023-07-06 09:47:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14129"}, "ts": "2023-07-06 09:48:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14129", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:48:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50294"}, "ts": "2023-07-06 09:48:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 09:48:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17323924", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 09:48:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17323924", "type": "PubMed"}, "ts": "2023-07-06 09:48:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6W4X9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:49:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6W4X9.664.664"}, "ts": "2023-07-06 09:49:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-06 09:49:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14550", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:49:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14550"}, "ts": "2023-07-06 09:49:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41222", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 09:50:59 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P41222", "cluster_type": "unselected"}, "ts": "2023-07-06 09:51:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96N22", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:51:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96N22.18.18"}, "ts": "2023-07-06 09:51:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41222", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 09:51:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VHI5"}, "ts": "2023-07-06 09:51:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VHI5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:51:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09871"}, "ts": "2023-07-06 09:51:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09871", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:51:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:51:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09871"}, "ts": "2023-07-06 09:51:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09871", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:51:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UFF9"}, "ts": "2023-07-06 09:51:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UFF9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:51:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P0DPD6.466.466"}, "ts": "2023-07-06 09:51:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DPD6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:51:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09497", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:51:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09497"}, "ts": "2023-07-06 09:51:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZL8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:52:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IZL8.557.557"}, "ts": "2023-07-06 09:52:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NP84.48.48"}, "ts": "2023-07-06 09:52:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP84", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:52:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TEV9"}, "ts": "2023-07-06 09:52:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TEV9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:52:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z304"}, "ts": "2023-07-06 09:52:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:52:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z304", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:52:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10981", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:52:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N4C6"}, "ts": "2023-07-06 09:52:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N4C6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:52:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56945", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:54:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56945"}, "ts": "2023-07-06 09:54:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14571.4.4"}, "ts": "2023-07-06 09:54:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14571", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:54:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P22105.91.91"}, "ts": "2023-07-06 09:54:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22105", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 09:54:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10980", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:55:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16357527", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 09:55:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16357527", "type": "PubMed"}, "ts": "2023-07-06 09:55:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYE3"}, "ts": "2023-07-06 09:55:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYE3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:55:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1908817", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 09:55:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1908817", "type": "PubMed"}, "ts": "2023-07-06 09:55:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4ADC0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 09:56:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4ADC0"}, "ts": "2023-07-06 09:56:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29853631", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 09:57:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29853631", "type": "PubMed"}, "ts": "2023-07-06 09:57:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29853631", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 09:57:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04671", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:57:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:58:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91Y03-1"}, "ts": "2023-07-06 09:58:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91Y03-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:58:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IXH7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 09:58:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IXH7"}, "ts": "2023-07-06 09:58:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G78800HY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 09:59:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G78800HY"}, "ts": "2023-07-06 09:59:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZR4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 09:59:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZR4-1"}, "ts": "2023-07-06 09:59:52 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-06 10:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-06 10:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 10:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-06 10:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-06 10:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-06 10:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60888", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:00:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60888"}, "ts": "2023-07-06 10:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:00:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O96000"}, "ts": "2023-07-06 10:00:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O96000", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:00:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96D71", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:00:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96D71.143.143"}, "ts": "2023-07-06 10:00:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2J8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:00:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2J8.246.246"}, "ts": "2023-07-06 10:00:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P30304.446.446"}, "ts": "2023-07-06 10:00:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30304", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:00:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05107-1"}, "ts": "2023-07-06 10:01:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05107-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 10:01:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:02:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N3V7"}, "ts": "2023-07-06 10:02:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3V7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:02:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01106-1"}, "ts": "2023-07-06 10:02:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VDF3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:02:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VDF3"}, "ts": "2023-07-06 10:02:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2E6"}, "ts": "2023-07-06 10:02:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K6N9"}, "ts": "2023-07-06 10:02:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K6N9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 10:02:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2E6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:02:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11177"}, "ts": "2023-07-06 10:03:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11177", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:03:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13797"}, "ts": "2023-07-06 10:04:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13797", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:04:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50294", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:04:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UWD8"}, "ts": "2023-07-06 10:04:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWD8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:04:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27661", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:05:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P27661.122.122"}, "ts": "2023-07-06 10:05:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6N043", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:05:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6N043"}, "ts": "2023-07-06 10:05:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2123345", "type": "PubMed"}, "ts": "2023-07-06 10:07:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2123345", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:08:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RI0"}, "ts": "2023-07-06 10:08:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RI0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:08:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96S82", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:08:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96S82.114.114"}, "ts": "2023-07-06 10:08:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U204-1"}, "ts": "2023-07-06 10:09:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U204-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:09:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q56R18", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:10:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q56R18"}, "ts": "2023-07-06 10:10:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:10:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BZZ2.511.511"}, "ts": "2023-07-06 10:10:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZZ2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:10:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NI47"}, "ts": "2023-07-06 10:10:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NI47", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 10:10:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZJ5"}, "ts": "2023-07-06 10:10:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12766"}, "ts": "2023-07-06 10:10:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12766", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:10:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYF1-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:10:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BYF1-1.53.53"}, "ts": "2023-07-06 10:10:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZJ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:11:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41271-1"}, "ts": "2023-07-06 10:11:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BVL2.483.483"}, "ts": "2023-07-06 10:12:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:12:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210-1"}, "ts": "2023-07-06 10:12:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:13:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NZI7.158.158"}, "ts": "2023-07-06 10:13:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZI7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:13:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75521"}, "ts": "2023-07-06 10:15:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75521", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 10:15:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:15:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96FE5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:15:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96FE5"}, "ts": "2023-07-06 10:15:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K3K1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:15:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K3K1"}, "ts": "2023-07-06 10:15:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04466"}, "ts": "2023-07-06 10:16:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04466", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:16:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1383201", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:16:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1383201", "type": "PubMed"}, "ts": "2023-07-06 10:16:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54709-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:16:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54709-1"}, "ts": "2023-07-06 10:16:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CR20", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 10:17:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CR20"}, "ts": "2023-07-06 10:17:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UVK1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:18:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UVK1"}, "ts": "2023-07-06 10:18:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:18:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96KN2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:18:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96KN2"}, "ts": "2023-07-06 10:18:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01106-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:18:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BKS4"}, "ts": "2023-07-06 10:18:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BKS4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 10:18:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:19:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63HK5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:19:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63HK5"}, "ts": "2023-07-06 10:19:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXN2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:19:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 10:19:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BXN2.112.112"}, "ts": "2023-07-06 10:19:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:19:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63HK5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:19:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63HK5"}, "ts": "2023-07-06 10:19:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:19:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63HK5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:19:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63HK5"}, "ts": "2023-07-06 10:19:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 10:19:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98862GW"}, "ts": "2023-07-06 10:19:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00613"}, "ts": "2023-07-06 10:20:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q06481.367.367"}, "ts": "2023-07-06 10:20:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06481", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:20:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULI2"}, "ts": "2023-07-06 10:20:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULI2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:20:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TD57.652.652"}, "ts": "2023-07-06 10:20:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TD57", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:20:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:20:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63HK5"}, "ts": "2023-07-06 10:20:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63HK5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:20:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65070RM"}, "ts": "2023-07-06 10:20:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35138101", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:20:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:20:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "35138101", "type": "PubMed"}, "ts": "2023-07-06 10:20:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39595FH"}, "ts": "2023-07-06 10:20:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30059200", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:20:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:20:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30059200", "type": "PubMed"}, "ts": "2023-07-06 10:20:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:21:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32938750", "type": "PubMed"}, "ts": "2023-07-06 10:21:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32938750", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:21:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:21:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19664995", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:21:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19664995", "type": "PubMed"}, "ts": "2023-07-06 10:21:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:21:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKJ8"}, "ts": "2023-07-06 10:21:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKJ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:21:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:21:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19413330", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:21:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19413330", "type": "PubMed"}, "ts": "2023-07-06 10:21:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95445"}, "ts": "2023-07-06 10:21:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95445", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:22:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27608TI"}, "ts": "2023-07-06 10:22:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VTA0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:22:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VTA0.110.110"}, "ts": "2023-07-06 10:22:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05850WN"}, "ts": "2023-07-06 10:22:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28247944", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:23:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28247944", "type": "PubMed"}, "ts": "2023-07-06 10:23:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8982255", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:23:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8982255", "type": "PubMed"}, "ts": "2023-07-06 10:23:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:23:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q17RC7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:23:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q17RC7"}, "ts": "2023-07-06 10:23:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02787"}, "ts": "2023-07-06 10:24:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:24:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02787", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:24:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-06 10:24:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-06 10:24:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03596YS"}, "ts": "2023-07-06 10:24:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04055MU"}, "ts": "2023-07-06 10:24:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04909DG"}, "ts": "2023-07-06 10:24:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06247RL"}, "ts": "2023-07-06 10:24:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-06 10:24:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08110WX"}, "ts": "2023-07-06 10:24:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08293MJ"}, "ts": "2023-07-06 10:24:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10486CT"}, "ts": "2023-07-06 10:24:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-06 10:24:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11911BT"}, "ts": "2023-07-06 10:24:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12579WK"}, "ts": "2023-07-06 10:24:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14994KB"}, "ts": "2023-07-06 10:24:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15038BD"}, "ts": "2023-07-06 10:24:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15508AW"}, "ts": "2023-07-06 10:24:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17168RO"}, "ts": "2023-07-06 10:24:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20425TQ"}, "ts": "2023-07-06 10:24:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22140GZ"}, "ts": "2023-07-06 10:24:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-06 10:24:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:24:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14247", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:24:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14247"}, "ts": "2023-07-06 10:24:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06187-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:25:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06187-1"}, "ts": "2023-07-06 10:25:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35658", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:25:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35658"}, "ts": "2023-07-06 10:25:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UIF9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:25:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UIF9.143.143"}, "ts": "2023-07-06 10:25:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X02", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:26:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86X02"}, "ts": "2023-07-06 10:26:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04003"}, "ts": "2023-07-06 10:26:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P4E1"}, "ts": "2023-07-06 10:26:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQ65", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:26:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TQ65"}, "ts": "2023-07-06 10:26:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96HR8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:26:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96HR8"}, "ts": "2023-07-06 10:26:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G29068FM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 10:26:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-06 10:26:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41271-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:26:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P4E1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:26:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00084IF"}, "ts": "2023-07-06 10:26:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01864SU"}, "ts": "2023-07-06 10:26:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07690SS"}, "ts": "2023-07-06 10:26:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06613LH"}, "ts": "2023-07-06 10:26:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12395OP"}, "ts": "2023-07-06 10:26:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19547DK"}, "ts": "2023-07-06 10:26:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23688HM"}, "ts": "2023-07-06 10:26:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28412UB"}, "ts": "2023-07-06 10:26:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29322AW"}, "ts": "2023-07-06 10:26:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32060MN"}, "ts": "2023-07-06 10:26:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33107NQ"}, "ts": "2023-07-06 10:26:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39010YA"}, "ts": "2023-07-06 10:26:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42014WZ"}, "ts": "2023-07-06 10:26:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42313WU"}, "ts": "2023-07-06 10:26:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43559EX"}, "ts": "2023-07-06 10:26:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44734PL"}, "ts": "2023-07-06 10:26:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46133ML"}, "ts": "2023-07-06 10:26:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 10:26:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52339OV"}, "ts": "2023-07-06 10:26:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56807DZ"}, "ts": "2023-07-06 10:26:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60241"}, "ts": "2023-07-06 10:26:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 10:26:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13813"}, "ts": "2023-07-06 10:26:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13813", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 10:27:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41350", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:27:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41350"}, "ts": "2023-07-06 10:27:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37231"}, "ts": "2023-07-06 10:28:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:28:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28231077", "type": "PubMed"}, "ts": "2023-07-06 10:29:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28231077", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:29:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H8Y8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:30:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H8Y8.269.269"}, "ts": "2023-07-06 10:30:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96577RX"}, "ts": "2023-07-06 10:30:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NXF8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:30:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NXF8-1"}, "ts": "2023-07-06 10:30:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30613"}, "ts": "2023-07-06 10:30:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54578", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:30:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54578.148.148"}, "ts": "2023-07-06 10:31:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97742"}, "ts": "2023-07-06 10:31:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2GUZ0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 10:31:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2GUZ0"}, "ts": "2023-07-06 10:31:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWV2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:32:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IWV2.211.211"}, "ts": "2023-07-06 10:32:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UVK1"}, "ts": "2023-07-06 10:33:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UVK1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:33:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:33:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPR9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:33:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPR9"}, "ts": "2023-07-06 10:33:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92859", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:33:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92859"}, "ts": "2023-07-06 10:33:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09073", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:34:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q09073"}, "ts": "2023-07-06 10:34:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N9R6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:34:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N9R6"}, "ts": "2023-07-06 10:34:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60857"}, "ts": "2023-07-06 10:34:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60857", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:34:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17535", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:35:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17535"}, "ts": "2023-07-06 10:35:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13421.425.425"}, "ts": "2023-07-06 10:35:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13421", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:35:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00613", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:36:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2K6.358.358"}, "ts": "2023-07-06 10:36:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2K6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:36:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3MIW9"}, "ts": "2023-07-06 10:37:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3MIW9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:37:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H6A9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:37:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25021"}, "ts": "2023-07-06 10:37:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25021", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:37:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H6A9.1569.1569"}, "ts": "2023-07-06 10:37:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUQ3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:37:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NUQ3.517.517"}, "ts": "2023-07-06 10:37:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60772"}, "ts": "2023-07-06 10:37:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60772", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:37:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D4K4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 10:38:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D4K4"}, "ts": "2023-07-06 10:39:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29083"}, "ts": "2023-07-06 10:39:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7543435", "type": "PubMed"}, "ts": "2023-07-06 10:40:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14522961", "type": "PubMed"}, "ts": "2023-07-06 10:41:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14522961", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:41:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:41:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21255825", "type": "PubMed"}, "ts": "2023-07-06 10:41:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21255825", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:41:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10608", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:41:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10608"}, "ts": "2023-07-06 10:41:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01897"}, "ts": "2023-07-06 10:41:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01897", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:41:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04003", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:42:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXJ8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:43:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BXJ8.107.107"}, "ts": "2023-07-06 10:43:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15800-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:43:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15800-1"}, "ts": "2023-07-06 10:43:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TBG9"}, "ts": "2023-07-06 10:43:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TBG9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:43:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37231", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:44:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60927", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:44:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60927"}, "ts": "2023-07-06 10:44:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P32322.278.278"}, "ts": "2023-07-06 10:44:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32322", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:44:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16112"}, "ts": "2023-07-06 10:44:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:45:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NS64", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:45:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NS64"}, "ts": "2023-07-06 10:45:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12401211", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:45:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12401211", "type": "PubMed"}, "ts": "2023-07-06 10:45:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92621.1710.1710"}, "ts": "2023-07-06 10:45:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92621", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:45:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NBJ4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:45:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NBJ4-1"}, "ts": "2023-07-06 10:45:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IYB5"}, "ts": "2023-07-06 10:45:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IYB5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:45:49 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 10:45:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 10:45:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 10:45:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:46:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16827"}, "ts": "2023-07-06 10:46:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16827", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:46:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96577RX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 10:46:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30613", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:46:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P80108"}, "ts": "2023-07-06 10:46:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49368"}, "ts": "2023-07-06 10:47:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G45209NR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 10:47:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49368", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:47:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97742", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:47:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUP9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:47:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NUP9"}, "ts": "2023-07-06 10:47:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10851391", "type": "PubMed"}, "ts": "2023-07-06 10:48:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10851391", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:48:52 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 10:49:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 10:49:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 10:49:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PFE7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:49:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PFE7"}, "ts": "2023-07-06 10:49:40 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 10:49:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 10:49:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 10:49:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:49:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34409942", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:49:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34409942", "type": "PubMed"}, "ts": "2023-07-06 10:49:57 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "gala(4)galb", "term_category": "any"}, "ts": "2023-07-06 10:50:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 10:50:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">7230a34feddc5e17540fdb64e4e9a1e4", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"gala(4)galb\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 10:50:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7230a34feddc5e17540fdb64e4e9a1e4", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 10:50:09 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "7230a34feddc5e17540fdb64e4e9a1e4", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 10:50:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6W3E5"}, "ts": "2023-07-06 10:50:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36191CD"}, "ts": "2023-07-06 10:50:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55220VL"}, "ts": "2023-07-06 10:50:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80966KZ"}, "ts": "2023-07-06 10:50:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-06 10:50:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78059CC"}, "ts": "2023-07-06 10:50:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84467IZ"}, "ts": "2023-07-06 10:50:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 10:50:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86357DX"}, "ts": "2023-07-06 10:50:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29857RC"}, "ts": "2023-07-06 10:50:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56749GV"}, "ts": "2023-07-06 10:50:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25520XG"}, "ts": "2023-07-06 10:50:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63889NK"}, "ts": "2023-07-06 10:50:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80858MF"}, "ts": "2023-07-06 10:50:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91365ZQ"}, "ts": "2023-07-06 10:50:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77252PU"}, "ts": "2023-07-06 10:50:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94531EZ"}, "ts": "2023-07-06 10:50:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82348BZ"}, "ts": "2023-07-06 10:50:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45359RY"}, "ts": "2023-07-06 10:50:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11041DA"}, "ts": "2023-07-06 10:50:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91413ZX"}, "ts": "2023-07-06 10:50:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95714", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:50:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95714.2454.2454"}, "ts": "2023-07-06 10:50:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BVL2.571.571"}, "ts": "2023-07-06 10:50:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BVL2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:50:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7230a34feddc5e17540fdb64e4e9a1e4", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 10:50:52 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "7230a34feddc5e17540fdb64e4e9a1e4", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}]}, "ts": "2023-07-06 10:50:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35670", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:50:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35670"}, "ts": "2023-07-06 10:50:58 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 10:51:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 10:51:09 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "7230a34feddc5e17540fdb64e4e9a1e4", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 10:51:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7230a34feddc5e17540fdb64e4e9a1e4", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-06 10:51:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7230a34feddc5e17540fdb64e4e9a1e4", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 10:51:31 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "gal a (4) gal b", "term_category": "any"}, "ts": "2023-07-06 10:51:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7230a34feddc5e17540fdb64e4e9a1e4>0c657face06b85171bf63b3e6b516e01", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"gal a (4) gal b\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 10:51:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0c657face06b85171bf63b3e6b516e01", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 10:51:32 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "0c657face06b85171bf63b3e6b516e01", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 10:51:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 10:51:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R155", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 10:51:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R155"}, "ts": "2023-07-06 10:51:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-06 10:51:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01031-1"}, "ts": "2023-07-06 10:51:50 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "0c657face06b85171bf63b3e6b516e01", "offset": 81, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 10:52:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59742GY"}, "ts": "2023-07-06 10:52:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37868ZX"}, "ts": "2023-07-06 10:52:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71013KY"}, "ts": "2023-07-06 10:52:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24413UY"}, "ts": "2023-07-06 10:52:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91023GB"}, "ts": "2023-07-06 10:52:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43694RQ"}, "ts": "2023-07-06 10:52:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56318NV"}, "ts": "2023-07-06 10:52:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33241WC"}, "ts": "2023-07-06 10:52:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90542MP"}, "ts": "2023-07-06 10:52:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52880ZN"}, "ts": "2023-07-06 10:52:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51562OR"}, "ts": "2023-07-06 10:52:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90348RI"}, "ts": "2023-07-06 10:52:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53276NK"}, "ts": "2023-07-06 10:52:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14548ZL"}, "ts": "2023-07-06 10:52:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43664YB"}, "ts": "2023-07-06 10:52:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37135JQ"}, "ts": "2023-07-06 10:52:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85767HW"}, "ts": "2023-07-06 10:52:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31991IV"}, "ts": "2023-07-06 10:52:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43346PX"}, "ts": "2023-07-06 10:52:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38022PE"}, "ts": "2023-07-06 10:52:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86WV1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:52:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86WV1"}, "ts": "2023-07-06 10:52:15 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 10:52:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 10:52:24 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "0c657face06b85171bf63b3e6b516e01", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 10:52:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0c657face06b85171bf63b3e6b516e01", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-06 10:52:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92563"}, "ts": "2023-07-06 10:52:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92563", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:52:37 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "gal(4)gal", "term_category": "any"}, "ts": "2023-07-06 10:52:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0c657face06b85171bf63b3e6b516e01", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 10:52:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0c657face06b85171bf63b3e6b516e01>ae14225967986b8246a5582c377087d0", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"gal(4)gal\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 10:52:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ae14225967986b8246a5582c377087d0", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 10:52:41 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "ae14225967986b8246a5582c377087d0", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 10:52:41 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "ae14225967986b8246a5582c377087d0", "offset": 81, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 10:53:00 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "ae14225967986b8246a5582c377087d0", "offset": 121, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 10:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79565XA"}, "ts": "2023-07-06 10:53:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07162IJ"}, "ts": "2023-07-06 10:53:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60227QI"}, "ts": "2023-07-06 10:53:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57835AK"}, "ts": "2023-07-06 10:53:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10258MC"}, "ts": "2023-07-06 10:53:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49305IN"}, "ts": "2023-07-06 10:53:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71906BW"}, "ts": "2023-07-06 10:53:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32659RY"}, "ts": "2023-07-06 10:53:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69170UT"}, "ts": "2023-07-06 10:53:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54018RP"}, "ts": "2023-07-06 10:53:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14998UC"}, "ts": "2023-07-06 10:53:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07483YN"}, "ts": "2023-07-06 10:53:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80319WU"}, "ts": "2023-07-06 10:53:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75120WS"}, "ts": "2023-07-06 10:53:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67173FM"}, "ts": "2023-07-06 10:53:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92681HQ"}, "ts": "2023-07-06 10:53:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56499YQ"}, "ts": "2023-07-06 10:53:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26935KA"}, "ts": "2023-07-06 10:53:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23345GE"}, "ts": "2023-07-06 10:53:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04791QM"}, "ts": "2023-07-06 10:53:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20086016", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:53:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20086016", "type": "PubMed"}, "ts": "2023-07-06 10:53:21 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "ae14225967986b8246a5582c377087d0", "offset": 161, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 10:53:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76294TY"}, "ts": "2023-07-06 10:53:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31532GK"}, "ts": "2023-07-06 10:53:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09576QH"}, "ts": "2023-07-06 10:53:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03895SR"}, "ts": "2023-07-06 10:53:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60963AS"}, "ts": "2023-07-06 10:53:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07410AW"}, "ts": "2023-07-06 10:53:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28948UC"}, "ts": "2023-07-06 10:53:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12222NC"}, "ts": "2023-07-06 10:53:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16150CJ"}, "ts": "2023-07-06 10:53:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98559XP"}, "ts": "2023-07-06 10:53:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88417ED"}, "ts": "2023-07-06 10:53:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61207RZ"}, "ts": "2023-07-06 10:53:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52676LZ"}, "ts": "2023-07-06 10:53:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63065KG"}, "ts": "2023-07-06 10:53:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53962WT"}, "ts": "2023-07-06 10:53:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23484GM"}, "ts": "2023-07-06 10:53:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68668TB"}, "ts": "2023-07-06 10:53:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09775CH"}, "ts": "2023-07-06 10:53:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75308SV"}, "ts": "2023-07-06 10:53:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59655SA"}, "ts": "2023-07-06 10:53:29 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "ae14225967986b8246a5582c377087d0", "offset": 201, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 10:53:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85542KD"}, "ts": "2023-07-06 10:53:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40702WU"}, "ts": "2023-07-06 10:53:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74264KM"}, "ts": "2023-07-06 10:53:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07947TY"}, "ts": "2023-07-06 10:53:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04273XP"}, "ts": "2023-07-06 10:53:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16679DU"}, "ts": "2023-07-06 10:53:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68758PE"}, "ts": "2023-07-06 10:53:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23626NI"}, "ts": "2023-07-06 10:53:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86298IX"}, "ts": "2023-07-06 10:53:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38217AM"}, "ts": "2023-07-06 10:53:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98366ZJ"}, "ts": "2023-07-06 10:53:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82811EP"}, "ts": "2023-07-06 10:53:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88948CY"}, "ts": "2023-07-06 10:53:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13156PQ"}, "ts": "2023-07-06 10:53:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95898GD"}, "ts": "2023-07-06 10:53:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24748QU"}, "ts": "2023-07-06 10:53:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97765TT"}, "ts": "2023-07-06 10:53:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76136FD"}, "ts": "2023-07-06 10:53:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07337US"}, "ts": "2023-07-06 10:53:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79394LC"}, "ts": "2023-07-06 10:53:45 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 10:54:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 10:54:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "ae14225967986b8246a5582c377087d0", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 10:54:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ae14225967986b8246a5582c377087d0", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-06 10:54:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ae14225967986b8246a5582c377087d0", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 10:54:21 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "alpha galactobiose", "term_category": "any"}, "ts": "2023-07-06 10:54:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ae14225967986b8246a5582c377087d0>21b1adaa69ede70b133dcca089a54da8", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"alpha galactobiose\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 10:54:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21b1adaa69ede70b133dcca089a54da8", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 10:54:22 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "21b1adaa69ede70b133dcca089a54da8", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 10:54:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21b1adaa69ede70b133dcca089a54da8", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 10:54:44 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "21b1adaa69ede70b133dcca089a54da8", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_mass", "operator": "OR", "selected": ["0k_1k"]}]}, "ts": "2023-07-06 10:54:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22768VO"}, "ts": "2023-07-06 10:54:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70994MS"}, "ts": "2023-07-06 10:54:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-06 10:54:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36123IU"}, "ts": "2023-07-06 10:54:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01614ZM"}, "ts": "2023-07-06 10:54:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65562ZE"}, "ts": "2023-07-06 10:54:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-06 10:54:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-06 10:54:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56682BC"}, "ts": "2023-07-06 10:54:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64973KT"}, "ts": "2023-07-06 10:54:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94435QH"}, "ts": "2023-07-06 10:54:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00033MO"}, "ts": "2023-07-06 10:54:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00395TQ"}, "ts": "2023-07-06 10:54:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96881BQ"}, "ts": "2023-07-06 10:54:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12396GB"}, "ts": "2023-07-06 10:54:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42797SX"}, "ts": "2023-07-06 10:54:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47180UC"}, "ts": "2023-07-06 10:54:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22573RC"}, "ts": "2023-07-06 10:54:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62167DK"}, "ts": "2023-07-06 10:54:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21b1adaa69ede70b133dcca089a54da8", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 10:54:48 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "21b1adaa69ede70b133dcca089a54da8", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_mass", "operator": "OR", "selected": ["0k_1k", "1k_2k"]}]}, "ts": "2023-07-06 10:54:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57818FI"}, "ts": "2023-07-06 10:54:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60230HH"}, "ts": "2023-07-06 10:54:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30159WR"}, "ts": "2023-07-06 10:54:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39213VZ"}, "ts": "2023-07-06 10:54:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58667NI"}, "ts": "2023-07-06 10:54:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27919IH"}, "ts": "2023-07-06 10:54:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22140GZ"}, "ts": "2023-07-06 10:54:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16828VN"}, "ts": "2023-07-06 10:54:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66937TJ"}, "ts": "2023-07-06 10:54:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12398HZ"}, "ts": "2023-07-06 10:54:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:54:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96D31", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:54:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96D31"}, "ts": "2023-07-06 10:54:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62258"}, "ts": "2023-07-06 10:55:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:55:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62258", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:55:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21b1adaa69ede70b133dcca089a54da8", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 10:55:04 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "21b1adaa69ede70b133dcca089a54da8", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_mass", "operator": "OR", "selected": ["0k_1k"]}]}, "ts": "2023-07-06 10:55:05 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "21b1adaa69ede70b133dcca089a54da8", "offset": 21, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_mass", "operator": "OR", "selected": ["0k_1k"]}]}, "ts": "2023-07-06 10:55:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21290RB"}, "ts": "2023-07-06 10:55:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00035MO"}, "ts": "2023-07-06 10:55:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71814NS"}, "ts": "2023-07-06 10:55:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77477NL"}, "ts": "2023-07-06 10:55:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15407YE"}, "ts": "2023-07-06 10:55:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94514IB"}, "ts": "2023-07-06 10:55:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59126YU"}, "ts": "2023-07-06 10:55:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30871VQ"}, "ts": "2023-07-06 10:55:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91875JA"}, "ts": "2023-07-06 10:55:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41424HD"}, "ts": "2023-07-06 10:55:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32152BH"}, "ts": "2023-07-06 10:55:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69500TM"}, "ts": "2023-07-06 10:55:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85608AG"}, "ts": "2023-07-06 10:55:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32723SL"}, "ts": "2023-07-06 10:55:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25780HH"}, "ts": "2023-07-06 10:55:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20624LQ"}, "ts": "2023-07-06 10:55:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63334FZ"}, "ts": "2023-07-06 10:55:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10756ZZ"}, "ts": "2023-07-06 10:55:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85862JT"}, "ts": "2023-07-06 10:55:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25323VU"}, "ts": "2023-07-06 10:55:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G25323VU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 10:56:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G25323VU"}, "ts": "2023-07-06 10:56:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000015"}, "ts": "2023-07-06 10:56:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-06 10:56:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28681TP"}, "ts": "2023-07-06 10:56:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04582LB"}, "ts": "2023-07-06 10:56:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64459DC"}, "ts": "2023-07-06 10:56:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXG9"}, "ts": "2023-07-06 10:56:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXG9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:56:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21b1adaa69ede70b133dcca089a54da8", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 10:57:00 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "21b1adaa69ede70b133dcca089a54da8", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 10:57:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 10:57:13 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 10:57:13 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "21b1adaa69ede70b133dcca089a54da8", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 10:57:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21b1adaa69ede70b133dcca089a54da8", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-06 10:57:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21b1adaa69ede70b133dcca089a54da8", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 10:57:24 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "alpha 4 galactobiose", "term_category": "any"}, "ts": "2023-07-06 10:57:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21b1adaa69ede70b133dcca089a54da8>1d40b292e88b9f415dbb4d596446c95d", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"alpha 4 galactobiose\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 10:57:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1d40b292e88b9f415dbb4d596446c95d", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 10:57:25 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "1d40b292e88b9f415dbb4d596446c95d", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 10:57:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09651.4.4"}, "ts": "2023-07-06 10:57:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09651", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:57:35 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "1d40b292e88b9f415dbb4d596446c95d", "offset": 61, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 10:57:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69411IG"}, "ts": "2023-07-06 10:57:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52934AK"}, "ts": "2023-07-06 10:57:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17155VX"}, "ts": "2023-07-06 10:57:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96719MC"}, "ts": "2023-07-06 10:57:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56516KW"}, "ts": "2023-07-06 10:57:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02311IE"}, "ts": "2023-07-06 10:57:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14127XU"}, "ts": "2023-07-06 10:57:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10228OD"}, "ts": "2023-07-06 10:57:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80537QW"}, "ts": "2023-07-06 10:57:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45560HM"}, "ts": "2023-07-06 10:57:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96503EZ"}, "ts": "2023-07-06 10:57:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16529MG"}, "ts": "2023-07-06 10:57:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68892PJ"}, "ts": "2023-07-06 10:57:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40194MN"}, "ts": "2023-07-06 10:57:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03754YM"}, "ts": "2023-07-06 10:57:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75850OP"}, "ts": "2023-07-06 10:57:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84330VA"}, "ts": "2023-07-06 10:57:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16774YZ"}, "ts": "2023-07-06 10:57:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45209NR"}, "ts": "2023-07-06 10:57:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89993FE"}, "ts": "2023-07-06 10:57:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1d40b292e88b9f415dbb4d596446c95d", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 10:57:49 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "1d40b292e88b9f415dbb4d596446c95d", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["Glycosphingolipid"]}]}, "ts": "2023-07-06 10:57:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-06 10:57:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23863VK"}, "ts": "2023-07-06 10:57:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-06 10:57:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-06 10:57:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14669DU"}, "ts": "2023-07-06 10:57:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74724QE"}, "ts": "2023-07-06 10:57:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23294PN"}, "ts": "2023-07-06 10:57:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10773YW"}, "ts": "2023-07-06 10:57:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63628AV"}, "ts": "2023-07-06 10:57:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44215PV"}, "ts": "2023-07-06 10:57:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80223IX"}, "ts": "2023-07-06 10:57:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33609NS"}, "ts": "2023-07-06 10:57:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72291OX"}, "ts": "2023-07-06 10:57:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91636VS"}, "ts": "2023-07-06 10:57:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66538GV"}, "ts": "2023-07-06 10:57:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82830MN"}, "ts": "2023-07-06 10:57:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94854LT"}, "ts": "2023-07-06 10:57:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82463GQ"}, "ts": "2023-07-06 10:57:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-06 10:57:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25418HZ"}, "ts": "2023-07-06 10:57:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1d40b292e88b9f415dbb4d596446c95d", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 10:57:58 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "1d40b292e88b9f415dbb4d596446c95d", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["Glycosphingolipid"]}, {"id": "by_mass", "operator": "OR", "selected": ["0k_1k"]}]}, "ts": "2023-07-06 10:57:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99375FM"}, "ts": "2023-07-06 10:58:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73004SD"}, "ts": "2023-07-06 10:58:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69791DF"}, "ts": "2023-07-06 10:58:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86056PA"}, "ts": "2023-07-06 10:58:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53434XO"}, "ts": "2023-07-06 10:58:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12733WO"}, "ts": "2023-07-06 10:58:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58896AZ"}, "ts": "2023-07-06 10:58:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57710SU"}, "ts": "2023-07-06 10:58:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00061MO"}, "ts": "2023-07-06 10:58:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01767JJ"}, "ts": "2023-07-06 10:58:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21856LC"}, "ts": "2023-07-06 10:58:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80062GG"}, "ts": "2023-07-06 10:58:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99053DY"}, "ts": "2023-07-06 10:58:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03277YI"}, "ts": "2023-07-06 10:58:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63813EJ"}, "ts": "2023-07-06 10:58:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67988RO"}, "ts": "2023-07-06 10:58:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12460DL"}, "ts": "2023-07-06 10:58:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G67988RO"}, "ts": "2023-07-06 10:58:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G67988RO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 10:58:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90960QG"}, "ts": "2023-07-06 10:58:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53230PK"}, "ts": "2023-07-06 10:58:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90627TW"}, "ts": "2023-07-06 10:58:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:58:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10620", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:58:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54652-1"}, "ts": "2023-07-06 10:59:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18347022", "type": "PubMed"}, "ts": "2023-07-06 10:59:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18347022", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:59:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9600862", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:59:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 10:59:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9600862", "type": "PubMed"}, "ts": "2023-07-06 10:59:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53680"}, "ts": "2023-07-06 10:59:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZ52", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 10:59:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IZ52"}, "ts": "2023-07-06 10:59:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZ11", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 10:59:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BZ11.776.776"}, "ts": "2023-07-06 10:59:56 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-06 11:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-06 11:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 11:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-06 11:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-06 11:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-06 11:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGA3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:01:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGA3"}, "ts": "2023-07-06 11:01:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:01:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13987", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:01:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13987"}, "ts": "2023-07-06 11:01:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80108", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:02:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NDA2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:03:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H158"}, "ts": "2023-07-06 11:03:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H158", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:03:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NDA2"}, "ts": "2023-07-06 11:03:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2VEC9"}, "ts": "2023-07-06 11:03:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2VEC9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:03:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:03:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EPQ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:03:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EPQ1"}, "ts": "2023-07-06 11:03:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G48414YA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 11:03:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60769"}, "ts": "2023-07-06 11:04:22 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P04062", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 11:05:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04062", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 11:05:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 11:05:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15164"}, "ts": "2023-07-06 11:05:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15003", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:05:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15003"}, "ts": "2023-07-06 11:06:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8842706", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 11:06:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8842706", "type": "PubMed"}, "ts": "2023-07-06 11:06:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01031-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:07:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78330"}, "ts": "2023-07-06 11:07:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16555-1"}, "ts": "2023-07-06 11:08:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75027"}, "ts": "2023-07-06 11:08:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15561"}, "ts": "2023-07-06 11:08:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:08:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15561", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:08:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47857"}, "ts": "2023-07-06 11:08:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47857", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:08:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34019948", "type": "PubMed"}, "ts": "2023-07-06 11:08:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 11:08:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34019948", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 11:08:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43155"}, "ts": "2023-07-06 11:09:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXA9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:09:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXA9"}, "ts": "2023-07-06 11:09:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58929CB"}, "ts": "2023-07-06 11:09:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-06 11:09:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52792"}, "ts": "2023-07-06 11:10:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52792", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:10:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25025"}, "ts": "2023-07-06 11:10:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:10:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25025", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:10:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G67988RO"}, "ts": "2023-07-06 11:12:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G67988RO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 11:12:20 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "1d40b292e88b9f415dbb4d596446c95d", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 11:12:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1d40b292e88b9f415dbb4d596446c95d", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 11:12:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49748"}, "ts": "2023-07-06 11:12:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1d40b292e88b9f415dbb4d596446c95d", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 11:12:44 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "1d40b292e88b9f415dbb4d596446c95d", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_mass", "operator": "OR", "selected": ["0k_1k"]}]}, "ts": "2023-07-06 11:12:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71142DF"}, "ts": "2023-07-06 11:12:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWI9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:14:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWI9"}, "ts": "2023-07-06 11:14:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61513"}, "ts": "2023-07-06 11:14:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P45844"}, "ts": "2023-07-06 11:14:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P45844", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:14:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54652-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:14:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N0W7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:14:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N0W7"}, "ts": "2023-07-06 11:14:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G35622MN"}, "ts": "2023-07-06 11:15:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 11:15:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G35622MN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 11:15:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G27964BX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 11:15:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 11:15:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G27964BX"}, "ts": "2023-07-06 11:15:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61803"}, "ts": "2023-07-06 11:15:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61803", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:15:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02246", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:15:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02246"}, "ts": "2023-07-06 11:15:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51149", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:15:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51149"}, "ts": "2023-07-06 11:15:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06213.43.43"}, "ts": "2023-07-06 11:15:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06213", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 11:15:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07737"}, "ts": "2023-07-06 11:15:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07737", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:15:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35811", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:15:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35811"}, "ts": "2023-07-06 11:15:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84676UY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 11:15:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46937-1"}, "ts": "2023-07-06 11:15:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULX7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:15:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53680", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:15:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G79198BK", "user": "Undecided", "type": "error", "page": "glycan", "message": "Network error. Glycan Detail api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-06 11:15:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01876-1"}, "ts": "2023-07-06 11:15:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84676UY", "user": "Undecided", "type": "error", "page": "glycan", "message": "Network error. Glycan Detail api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-06 11:15:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14318", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:15:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14318"}, "ts": "2023-07-06 11:15:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NH83"}, "ts": "2023-07-06 11:16:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:16:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NH83", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:16:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43448"}, "ts": "2023-07-06 11:18:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43448", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:18:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94855"}, "ts": "2023-07-06 11:18:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 11:19:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94915.1432.1432"}, "ts": "2023-07-06 11:19:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94915", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 11:19:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G50737AO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 11:19:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G50737AO"}, "ts": "2023-07-06 11:19:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:21:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y274-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:21:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y274-1"}, "ts": "2023-07-06 11:21:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HC78"}, "ts": "2023-07-06 11:21:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HC78", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:21:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99956MJ"}, "ts": "2023-07-06 11:21:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99954ZJ"}, "ts": "2023-07-06 11:21:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99943EE"}, "ts": "2023-07-06 11:21:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99896CG"}, "ts": "2023-07-06 11:21:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99891PR"}, "ts": "2023-07-06 11:21:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99954GW"}, "ts": "2023-07-06 11:21:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99866WK"}, "ts": "2023-07-06 11:21:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99729IU"}, "ts": "2023-07-06 11:21:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99714FV"}, "ts": "2023-07-06 11:21:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99584SF"}, "ts": "2023-07-06 11:21:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99571EV"}, "ts": "2023-07-06 11:21:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99568AR"}, "ts": "2023-07-06 11:21:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99511SH"}, "ts": "2023-07-06 11:21:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99452IK"}, "ts": "2023-07-06 11:21:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99448WD"}, "ts": "2023-07-06 11:21:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99403QU"}, "ts": "2023-07-06 11:21:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99356PZ"}, "ts": "2023-07-06 11:21:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99306JE"}, "ts": "2023-07-06 11:21:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99258WN"}, "ts": "2023-07-06 11:21:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99242KO"}, "ts": "2023-07-06 11:21:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02030ZB"}, "ts": "2023-07-06 11:21:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20210JR"}, "ts": "2023-07-06 11:21:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24954UD"}, "ts": "2023-07-06 11:21:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51640FO"}, "ts": "2023-07-06 11:21:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-06 11:21:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-06 11:21:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80223IX"}, "ts": "2023-07-06 11:21:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84820NF"}, "ts": "2023-07-06 11:21:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86795LJ"}, "ts": "2023-07-06 11:21:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95133RI"}, "ts": "2023-07-06 11:21:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99966GV"}, "ts": "2023-07-06 11:21:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15164", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:21:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q812G0"}, "ts": "2023-07-06 11:21:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q812G0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:21:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68372", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:23:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68372"}, "ts": "2023-07-06 11:23:00 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 11:23:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 11:23:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 11:23:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z2W7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 11:23:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z2W7.934.934"}, "ts": "2023-07-06 11:23:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28326HR"}, "ts": "2023-07-06 11:24:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41143"}, "ts": "2023-07-06 11:24:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41143", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:24:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75027", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:24:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16555-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:24:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55317", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:24:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55317"}, "ts": "2023-07-06 11:24:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:24:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZSY5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:24:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZSY5"}, "ts": "2023-07-06 11:24:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21740066", "type": "PubMed"}, "ts": "2023-07-06 11:24:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 11:24:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21740066", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 11:24:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07195"}, "ts": "2023-07-06 11:24:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43155", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:25:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64527OM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 11:25:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z2W7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 11:25:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 11:25:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z2W7.934.934"}, "ts": "2023-07-06 11:25:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16581"}, "ts": "2023-07-06 11:25:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:25:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16581", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:25:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NXK8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:25:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NXK8"}, "ts": "2023-07-06 11:25:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19320"}, "ts": "2023-07-06 11:26:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:26:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19320", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:26:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DAN8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:26:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16623.118.118"}, "ts": "2023-07-06 11:27:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16623", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 11:27:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16402"}, "ts": "2023-07-06 11:27:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16402", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:27:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VDN2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:27:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VDN2"}, "ts": "2023-07-06 11:27:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49908"}, "ts": "2023-07-06 11:27:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00033MO"}, "ts": "2023-07-06 11:28:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:28:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25788", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:28:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25788"}, "ts": "2023-07-06 11:28:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49748", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:28:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16778"}, "ts": "2023-07-06 11:28:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16778", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:28:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20930", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:29:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20930"}, "ts": "2023-07-06 11:29:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 11:29:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61513", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:29:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05106", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 11:30:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05106.524.524"}, "ts": "2023-07-06 11:30:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02246"}, "ts": "2023-07-06 11:30:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02246", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:30:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60313"}, "ts": "2023-07-06 11:30:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60313", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:30:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96NU0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:30:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96NU0"}, "ts": "2023-07-06 11:30:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86XA9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 11:30:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86XA9"}, "ts": "2023-07-06 11:30:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46937-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:31:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01876-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:31:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14194", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:31:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14194"}, "ts": "2023-07-06 11:31:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14994"}, "ts": "2023-07-06 11:32:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14994", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:32:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JL27", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:33:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JL27"}, "ts": "2023-07-06 11:33:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17535"}, "ts": "2023-07-06 11:33:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17535", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:33:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P38432"}, "ts": "2023-07-06 11:33:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P38432"}, "ts": "2023-07-06 11:33:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94855", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:34:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16549"}, "ts": "2023-07-06 11:35:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16549", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:35:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49961", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:35:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49961"}, "ts": "2023-07-06 11:35:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:35:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94916", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:35:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94916"}, "ts": "2023-07-06 11:35:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGP8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:35:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UGP8"}, "ts": "2023-07-06 11:35:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:35:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01215", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:35:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01215"}, "ts": "2023-07-06 11:35:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-06 11:35:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06209KS"}, "ts": "2023-07-06 11:35:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08185DV"}, "ts": "2023-07-06 11:35:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-06 11:35:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10258MC"}, "ts": "2023-07-06 11:35:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11870QZ"}, "ts": "2023-07-06 11:35:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14047PA"}, "ts": "2023-07-06 11:35:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14358WN"}, "ts": "2023-07-06 11:35:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14996IQ"}, "ts": "2023-07-06 11:35:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14998UC"}, "ts": "2023-07-06 11:35:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16758MX"}, "ts": "2023-07-06 11:35:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16828VN"}, "ts": "2023-07-06 11:35:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-06 11:35:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23294PN"}, "ts": "2023-07-06 11:35:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24131KD"}, "ts": "2023-07-06 11:35:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24413UY"}, "ts": "2023-07-06 11:35:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24835MQ"}, "ts": "2023-07-06 11:35:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24954RW"}, "ts": "2023-07-06 11:35:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25835MT"}, "ts": "2023-07-06 11:35:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26403SG"}, "ts": "2023-07-06 11:35:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04077XA"}, "ts": "2023-07-06 11:35:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29857RC"}, "ts": "2023-07-06 11:35:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36191CD"}, "ts": "2023-07-06 11:35:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38217AM"}, "ts": "2023-07-06 11:35:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39540XG"}, "ts": "2023-07-06 11:35:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 11:35:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23301498", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 11:35:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23301498", "type": "PubMed"}, "ts": "2023-07-06 11:35:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QXU9-1"}, "ts": "2023-07-06 11:36:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QXU9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:36:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88888-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:36:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88888-1"}, "ts": "2023-07-06 11:36:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07001", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:37:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q07001"}, "ts": "2023-07-06 11:37:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84676UY"}, "ts": "2023-07-06 11:37:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84676UY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 11:37:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53778"}, "ts": "2023-07-06 11:38:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UZ18-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:40:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UZ18-1"}, "ts": "2023-07-06 11:40:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07195", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:40:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47825-1"}, "ts": "2023-07-06 11:40:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:40:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47825-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:40:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62278-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:40:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62278-1"}, "ts": "2023-07-06 11:40:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18858"}, "ts": "2023-07-06 11:40:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18858", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:41:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 11:41:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99P99-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:41:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99P99-1"}, "ts": "2023-07-06 11:41:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4C5"}, "ts": "2023-07-06 11:42:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4C5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:42:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PD5"}, "ts": "2023-07-06 11:42:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9Q8T7-1"}, "ts": "2023-07-06 11:42:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q8T7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:42:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6W4X9"}, "ts": "2023-07-06 11:42:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:42:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6W4X9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:42:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-06 11:42:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83555HU"}, "ts": "2023-07-06 11:42:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96577RX"}, "ts": "2023-07-06 11:42:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25451PN"}, "ts": "2023-07-06 11:42:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49955PK"}, "ts": "2023-07-06 11:42:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66933CM"}, "ts": "2023-07-06 11:42:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15169WU"}, "ts": "2023-07-06 11:42:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O96024"}, "ts": "2023-07-06 11:42:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O96024", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:42:41 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 11:43:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 11:43:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 11:43:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-06 11:43:07 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 11:43:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-06 11:43:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 11:43:17 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "P14210", "term_category": "any"}, "ts": "2023-07-06 11:43:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">7e3135295dec0af9332438bb84be0ded", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"P14210\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 11:43:18 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 11:43:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7e3135295dec0af9332438bb84be0ded", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 11:43:18 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "7e3135295dec0af9332438bb84be0ded", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 11:43:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 11:43:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G43417UB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 11:43:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-06 11:43:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2295701", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 11:43:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2295701", "type": "PubMed"}, "ts": "2023-07-06 11:43:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7e3135295dec0af9332438bb84be0ded", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 11:43:35 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "7e3135295dec0af9332438bb84be0ded", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": [{"id": "by_ptm", "operator": "OR", "selected": ["N-Glycosylation reported"]}]}, "ts": "2023-07-06 11:43:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:43:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210-1"}, "ts": "2023-07-06 11:43:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49908", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:43:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19059PI"}, "ts": "2023-07-06 11:43:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-06 11:43:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01543ZX"}, "ts": "2023-07-06 11:43:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-06 11:43:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 11:43:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-06 11:43:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52126RR"}, "ts": "2023-07-06 11:43:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-06 11:43:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57789QC"}, "ts": "2023-07-06 11:43:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60542VK"}, "ts": "2023-07-06 11:43:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64394MX"}, "ts": "2023-07-06 11:43:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74239ZQ"}, "ts": "2023-07-06 11:43:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77252PU"}, "ts": "2023-07-06 11:43:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89664KV"}, "ts": "2023-07-06 11:43:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93656SY"}, "ts": "2023-07-06 11:43:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BU40"}, "ts": "2023-07-06 11:44:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BU40", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:44:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00033MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 11:44:10 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 11:44:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 11:44:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q66HL2.429.429"}, "ts": "2023-07-06 11:44:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66HL2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 11:44:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:44:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NS68"}, "ts": "2023-07-06 11:44:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NS68", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:44:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14994", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:45:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14994"}, "ts": "2023-07-06 11:45:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PIL6"}, "ts": "2023-07-06 11:45:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PIL6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:45:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "about", "message": "page access"}, "ts": "2023-07-06 11:45:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99961", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:46:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99961"}, "ts": "2023-07-06 11:46:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z570", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:46:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z570"}, "ts": "2023-07-06 11:46:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12830"}, "ts": "2023-07-06 11:47:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05121"}, "ts": "2023-07-06 11:47:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57076", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:48:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P57076"}, "ts": "2023-07-06 11:48:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95633"}, "ts": "2023-07-06 11:48:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95633", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:48:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15305"}, "ts": "2023-07-06 11:48:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15305", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:48:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z3D6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:48:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z3D6"}, "ts": "2023-07-06 11:48:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38432", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:49:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38432", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:49:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 11:49:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 11:50:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y289", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 11:51:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y289"}, "ts": "2023-07-06 11:51:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43004"}, "ts": "2023-07-06 11:51:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43004", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:51:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRM0"}, "ts": "2023-07-06 11:51:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:51:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16519522", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 11:51:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16519522", "type": "PubMed"}, "ts": "2023-07-06 11:51:20 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 11:51:30 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-06 11:51:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-06 11:51:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-06 11:51:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "Performing Quick Search"}, "ts": "2023-07-06 11:51:38 EDT-0400"}, {"api": "/usecases/species_to_glycosyltransferases/", "req": {"tax_id": 10116}, "ts": "2023-07-06 11:51:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">84d35715e14816eb6c91c1abc922024a", "user": "Undecided", "type": "user", "page": "quick-search", "message": "Quick Search Question_8 = /10116"}, "ts": "2023-07-06 11:51:39 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 11:51:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "84d35715e14816eb6c91c1abc922024a", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 11:51:39 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "84d35715e14816eb6c91c1abc922024a", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 11:51:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NZQ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:52:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NZQ8"}, "ts": "2023-07-06 11:52:02 EDT-0400"}, {"api": "/motif/list/", "req": {"offset": 1, "sort": "glycan_count", "limit": 150, "order": "desc"}, "ts": "2023-07-06 11:52:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-06 11:52:18 EDT-0400"}, {"api": "/motif/list/", "req": {"offset": 1, "sort": "glycan_count", "limit": 150, "order": "desc"}, "ts": "2023-07-06 11:52:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-06 11:52:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000019"}, "ts": "2023-07-06 11:52:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000018"}, "ts": "2023-07-06 11:52:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000002"}, "ts": "2023-07-06 11:52:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000005"}, "ts": "2023-07-06 11:52:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000042"}, "ts": "2023-07-06 11:52:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000034"}, "ts": "2023-07-06 11:52:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000020"}, "ts": "2023-07-06 11:52:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000036"}, "ts": "2023-07-06 11:52:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000016"}, "ts": "2023-07-06 11:52:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000045"}, "ts": "2023-07-06 11:52:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000015"}, "ts": "2023-07-06 11:52:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-06 11:52:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000022"}, "ts": "2023-07-06 11:52:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000004"}, "ts": "2023-07-06 11:52:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000038"}, "ts": "2023-07-06 11:52:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000035"}, "ts": "2023-07-06 11:52:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000003"}, "ts": "2023-07-06 11:52:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000021"}, "ts": "2023-07-06 11:52:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000031"}, "ts": "2023-07-06 11:52:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000050"}, "ts": "2023-07-06 11:52:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000049"}, "ts": "2023-07-06 11:52:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000017"}, "ts": "2023-07-06 11:52:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000024"}, "ts": "2023-07-06 11:52:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000051"}, "ts": "2023-07-06 11:52:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000006"}, "ts": "2023-07-06 11:52:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000044"}, "ts": "2023-07-06 11:52:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000033"}, "ts": "2023-07-06 11:52:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000043"}, "ts": "2023-07-06 11:52:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000037"}, "ts": "2023-07-06 11:52:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000026"}, "ts": "2023-07-06 11:52:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000032"}, "ts": "2023-07-06 11:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000029"}, "ts": "2023-07-06 11:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000041"}, "ts": "2023-07-06 11:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000039"}, "ts": "2023-07-06 11:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000047"}, "ts": "2023-07-06 11:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000058"}, "ts": "2023-07-06 11:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000027"}, "ts": "2023-07-06 11:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000040"}, "ts": "2023-07-06 11:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000046"}, "ts": "2023-07-06 11:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000252"}, "ts": "2023-07-06 11:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000030"}, "ts": "2023-07-06 11:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000057"}, "ts": "2023-07-06 11:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000025"}, "ts": "2023-07-06 11:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000074"}, "ts": "2023-07-06 11:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000118"}, "ts": "2023-07-06 11:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000095"}, "ts": "2023-07-06 11:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000100"}, "ts": "2023-07-06 11:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000064"}, "ts": "2023-07-06 11:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000055"}, "ts": "2023-07-06 11:52:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000078"}, "ts": "2023-07-06 11:52:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000091"}, "ts": "2023-07-06 11:52:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000089"}, "ts": "2023-07-06 11:52:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000104"}, "ts": "2023-07-06 11:52:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000060"}, "ts": "2023-07-06 11:52:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000085"}, "ts": "2023-07-06 11:52:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000108"}, "ts": "2023-07-06 11:52:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000110"}, "ts": "2023-07-06 11:52:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000121"}, "ts": "2023-07-06 11:52:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000059"}, "ts": "2023-07-06 11:52:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000012"}, "ts": "2023-07-06 11:52:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000081"}, "ts": "2023-07-06 11:52:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000068"}, "ts": "2023-07-06 11:52:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000114"}, "ts": "2023-07-06 11:52:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000070"}, "ts": "2023-07-06 11:52:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000099"}, "ts": "2023-07-06 11:52:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000084"}, "ts": "2023-07-06 11:52:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000109"}, "ts": "2023-07-06 11:52:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000111"}, "ts": "2023-07-06 11:52:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000075"}, "ts": "2023-07-06 11:52:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000120"}, "ts": "2023-07-06 11:52:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000013"}, "ts": "2023-07-06 11:52:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000080"}, "ts": "2023-07-06 11:52:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000069"}, "ts": "2023-07-06 11:52:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000115"}, "ts": "2023-07-06 11:52:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000071"}, "ts": "2023-07-06 11:52:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000098"}, "ts": "2023-07-06 11:52:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000119"}, "ts": "2023-07-06 11:52:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000094"}, "ts": "2023-07-06 11:52:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000007"}, "ts": "2023-07-06 11:52:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000101"}, "ts": "2023-07-06 11:52:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000065"}, "ts": "2023-07-06 11:52:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000054"}, "ts": "2023-07-06 11:52:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000079"}, "ts": "2023-07-06 11:52:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000090"}, "ts": "2023-07-06 11:52:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000088"}, "ts": "2023-07-06 11:52:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000105"}, "ts": "2023-07-06 11:52:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000061"}, "ts": "2023-07-06 11:52:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000086"}, "ts": "2023-07-06 11:52:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000113"}, "ts": "2023-07-06 11:52:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000077"}, "ts": "2023-07-06 11:52:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000122"}, "ts": "2023-07-06 11:52:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000011"}, "ts": "2023-07-06 11:52:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000082"}, "ts": "2023-07-06 11:52:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000009"}, "ts": "2023-07-06 11:52:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000117"}, "ts": "2023-07-06 11:52:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000073"}, "ts": "2023-07-06 11:52:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000096"}, "ts": "2023-07-06 11:52:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000103"}, "ts": "2023-07-06 11:52:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000067"}, "ts": "2023-07-06 11:52:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000056"}, "ts": "2023-07-06 11:52:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000092"}, "ts": "2023-07-06 11:52:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000028"}, "ts": "2023-07-06 11:52:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000107"}, "ts": "2023-07-06 11:52:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000063"}, "ts": "2023-07-06 11:52:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000097"}, "ts": "2023-07-06 11:52:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000102"}, "ts": "2023-07-06 11:52:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000066"}, "ts": "2023-07-06 11:52:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000093"}, "ts": "2023-07-06 11:52:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000053"}, "ts": "2023-07-06 11:52:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000106"}, "ts": "2023-07-06 11:52:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000062"}, "ts": "2023-07-06 11:52:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000087"}, "ts": "2023-07-06 11:52:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000014"}, "ts": "2023-07-06 11:52:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000112"}, "ts": "2023-07-06 11:52:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000076"}, "ts": "2023-07-06 11:52:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000010"}, "ts": "2023-07-06 11:52:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000083"}, "ts": "2023-07-06 11:52:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000008"}, "ts": "2023-07-06 11:52:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000116"}, "ts": "2023-07-06 11:52:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000072"}, "ts": "2023-07-06 11:52:26 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-06 11:52:32 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 11:52:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-06 11:52:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H9L7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 11:53:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H9L7.72.72"}, "ts": "2023-07-06 11:53:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53778", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:54:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 11:54:59 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 11:54:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "try-me", "message": "page access"}, "ts": "2023-07-06 11:55:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGX3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:55:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29122"}, "ts": "2023-07-06 11:55:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VWX1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:55:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VWX1"}, "ts": "2023-07-06 11:55:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75356-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:55:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75356-1"}, "ts": "2023-07-06 11:55:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P83917"}, "ts": "2023-07-06 11:56:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 11:57:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33171153", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 11:57:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33171153", "type": "PubMed"}, "ts": "2023-07-06 11:57:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05784"}, "ts": "2023-07-06 11:57:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05784", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:57:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02223", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:58:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02223"}, "ts": "2023-07-06 11:58:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75462"}, "ts": "2023-07-06 11:59:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75462", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 11:59:50 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-06 12:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-06 12:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 12:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-06 12:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-06 12:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-06 12:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60502"}, "ts": "2023-07-06 12:00:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14318"}, "ts": "2023-07-06 12:00:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14318", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:00:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08754", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:00:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08754"}, "ts": "2023-07-06 12:00:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G79198BK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 12:00:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G79198BK"}, "ts": "2023-07-06 12:00:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4C4"}, "ts": "2023-07-06 12:00:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4C4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:00:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TB45"}, "ts": "2023-07-06 12:00:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TB45", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:00:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G12398HZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 12:00:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96JP2"}, "ts": "2023-07-06 12:00:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JP2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:00:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BID6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:00:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BID6-1"}, "ts": "2023-07-06 12:00:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AN5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:00:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AN5"}, "ts": "2023-07-06 12:00:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G46455GO"}, "ts": "2023-07-06 12:01:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G46455GO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 12:01:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 12:02:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19712047", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 12:02:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19712047", "type": "PubMed"}, "ts": "2023-07-06 12:02:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05121", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:02:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12830", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:03:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGX3"}, "ts": "2023-07-06 12:03:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQS5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:04:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQS5"}, "ts": "2023-07-06 12:04:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z4F1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:05:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z4F1.299.299"}, "ts": "2023-07-06 12:05:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BQB4"}, "ts": "2023-07-06 12:07:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BQB4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:07:53 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-06 12:08:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-06 12:08:11 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 12:08:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "try-me", "message": "page access"}, "ts": "2023-07-06 12:08:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "about", "message": "page access"}, "ts": "2023-07-06 12:08:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 12:08:16 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 12:08:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210-1"}, "ts": "2023-07-06 12:08:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:08:21 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 12:08:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7e3135295dec0af9332438bb84be0ded", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 12:08:21 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "7e3135295dec0af9332438bb84be0ded", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 12:08:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-06 12:08:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 12:08:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18295XA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 12:08:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18295XA"}, "ts": "2023-07-06 12:08:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89291WX"}, "ts": "2023-07-06 12:09:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JL27", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:09:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JL27"}, "ts": "2023-07-06 12:09:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47929", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:09:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47929"}, "ts": "2023-07-06 12:09:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92793", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:09:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01588-1"}, "ts": "2023-07-06 12:10:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13667", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:10:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13667"}, "ts": "2023-07-06 12:10:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17827158", "type": "PubMed"}, "ts": "2023-07-06 12:10:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17827158", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 12:10:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78386"}, "ts": "2023-07-06 12:10:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000090"}, "ts": "2023-07-06 12:11:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29122", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:11:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01897"}, "ts": "2023-07-06 12:11:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01897", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:11:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14686"}, "ts": "2023-07-06 12:12:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NR56"}, "ts": "2023-07-06 12:12:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NR56", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 12:12:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3TQI7-1"}, "ts": "2023-07-06 12:13:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TQI7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:13:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5SVZ6"}, "ts": "2023-07-06 12:14:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SVZ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:14:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4C1"}, "ts": "2023-07-06 12:14:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:15:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4C1", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:15:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0VF49", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:15:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0VF49"}, "ts": "2023-07-06 12:15:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:15:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43235"}, "ts": "2023-07-06 12:15:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43235", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:15:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60502", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:16:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:16:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZ95", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:16:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZ95"}, "ts": "2023-07-06 12:16:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZKP8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:16:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZKP8"}, "ts": "2023-07-06 12:16:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXH8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:16:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UXH8"}, "ts": "2023-07-06 12:16:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95947-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:16:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95947-1"}, "ts": "2023-07-06 12:16:32 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 12:16:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 12:16:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 12:16:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:17:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27352", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:17:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27352"}, "ts": "2023-07-06 12:17:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAU5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:18:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G86357DX"}, "ts": "2023-07-06 12:18:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:18:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGI8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:18:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03188", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:19:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q03188.602.602"}, "ts": "2023-07-06 12:19:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08069"}, "ts": "2023-07-06 12:19:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:20:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47974", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:20:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P47974.318.318"}, "ts": "2023-07-06 12:20:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWZ7"}, "ts": "2023-07-06 12:21:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:21:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWZ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:21:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46060", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:21:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46060"}, "ts": "2023-07-06 12:21:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 12:21:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q32KG4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 12:21:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q32KG4"}, "ts": "2023-07-06 12:21:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75140"}, "ts": "2023-07-06 12:22:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WV24", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:23:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13501"}, "ts": "2023-07-06 12:23:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WV24"}, "ts": "2023-07-06 12:23:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HAU5"}, "ts": "2023-07-06 12:23:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15381.295.295"}, "ts": "2023-07-06 12:23:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15381", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:23:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULX7"}, "ts": "2023-07-06 12:23:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULX7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:23:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35236", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:23:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35236.110.110"}, "ts": "2023-07-06 12:24:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68FQ2"}, "ts": "2023-07-06 12:25:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:25:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46976"}, "ts": "2023-07-06 12:25:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46976", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:25:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68FQ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:25:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18428"}, "ts": "2023-07-06 12:25:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8MTB9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 12:26:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A8MTB9"}, "ts": "2023-07-06 12:26:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKE5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:26:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKE5"}, "ts": "2023-07-06 12:26:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01588-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:26:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20223214", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 12:26:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20223214", "type": "PubMed"}, "ts": "2023-07-06 12:26:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08851-1"}, "ts": "2023-07-06 12:26:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08851-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:26:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78386", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:26:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y230"}, "ts": "2023-07-06 12:26:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y230", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:26:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:26:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51149"}, "ts": "2023-07-06 12:27:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51149", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:27:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JHU4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:27:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JHU4-1"}, "ts": "2023-07-06 12:27:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CP2"}, "ts": "2023-07-06 12:27:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CP2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:27:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RQ3"}, "ts": "2023-07-06 12:27:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:27:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RQ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:27:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95714", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 12:27:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95714"}, "ts": "2023-07-06 12:27:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14686", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:28:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28666"}, "ts": "2023-07-06 12:28:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28666", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:28:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06737"}, "ts": "2023-07-06 12:28:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15118", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:29:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15118.443.443"}, "ts": "2023-07-06 12:29:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5H9R4"}, "ts": "2023-07-06 12:29:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5H9R4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:29:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68037", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 12:29:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68037"}, "ts": "2023-07-06 12:29:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WYB5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:30:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9842986", "type": "PubMed"}, "ts": "2023-07-06 12:30:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9842986", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 12:30:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00534", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:30:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00534"}, "ts": "2023-07-06 12:30:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WYB5"}, "ts": "2023-07-06 12:30:22 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q62137-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 12:30:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62137-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 12:30:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:31:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9D219.352.352"}, "ts": "2023-07-06 12:31:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D219", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:31:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60237.378.378"}, "ts": "2023-07-06 12:31:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60237", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:31:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38159", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:31:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P38159"}, "ts": "2023-07-06 12:31:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56974"}, "ts": "2023-07-06 12:32:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56974", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:32:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q70Z44"}, "ts": "2023-07-06 12:32:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q70Z44", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:32:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27068747", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 12:32:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27068747", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 12:32:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 12:32:29 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P25801", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 12:32:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25801", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 12:32:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2I2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:32:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2I2.392.392"}, "ts": "2023-07-06 12:32:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:33:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGM5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:33:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UGM5.136.136"}, "ts": "2023-07-06 12:33:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43432.1478.1478"}, "ts": "2023-07-06 12:33:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43432", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:33:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2M2H8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:33:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2M2H8"}, "ts": "2023-07-06 12:33:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D659", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:33:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D659"}, "ts": "2023-07-06 12:33:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P98174.51.51"}, "ts": "2023-07-06 12:33:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98174", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:33:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VEM9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:33:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VEM9"}, "ts": "2023-07-06 12:34:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G86357DX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 12:34:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14647"}, "ts": "2023-07-06 12:35:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14647", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 12:35:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59279-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:35:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59279-1"}, "ts": "2023-07-06 12:35:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08069", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:35:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55099"}, "ts": "2023-07-06 12:36:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55099", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:36:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G70994MS"}, "ts": "2023-07-06 12:36:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G70994MS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 12:36:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NGB9"}, "ts": "2023-07-06 12:36:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NGB9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:36:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TSF2"}, "ts": "2023-07-06 12:37:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TSF2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 12:37:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75925"}, "ts": "2023-07-06 12:37:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:37:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75925", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:37:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14618"}, "ts": "2023-07-06 12:37:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14618", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:37:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z123", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:37:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z123"}, "ts": "2023-07-06 12:37:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H3N1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:37:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H3N1.253.253"}, "ts": "2023-07-06 12:37:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51610.262.262"}, "ts": "2023-07-06 12:38:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51610", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:38:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRH1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:38:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRH1-1"}, "ts": "2023-07-06 12:38:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34283274", "type": "PubMed"}, "ts": "2023-07-06 12:38:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34283274", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 12:38:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34283274", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 12:38:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZDI6-1"}, "ts": "2023-07-06 12:38:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZDI6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:38:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13501", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:39:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19363159", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 12:39:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19363159", "type": "PubMed"}, "ts": "2023-07-06 12:39:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34290249", "type": "PubMed"}, "ts": "2023-07-06 12:39:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34290249", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 12:39:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34290249", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 12:39:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZSZ5-4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:39:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZSZ5-4"}, "ts": "2023-07-06 12:39:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02447-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:39:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02447-1"}, "ts": "2023-07-06 12:39:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBH5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:39:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HBH5"}, "ts": "2023-07-06 12:39:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60637"}, "ts": "2023-07-06 12:39:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60637", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:39:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15104-1"}, "ts": "2023-07-06 12:40:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00955WX"}, "ts": "2023-07-06 12:40:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 12:40:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00955WX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 12:40:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34947-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:41:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P34947-1"}, "ts": "2023-07-06 12:41:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08670"}, "ts": "2023-07-06 12:41:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18428", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:41:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94805", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:41:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94805"}, "ts": "2023-07-06 12:41:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NU22-1.602.602"}, "ts": "2023-07-06 12:42:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NU22-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:42:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TQI7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:42:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3TQI7"}, "ts": "2023-07-06 12:42:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92794", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:42:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92794.420.420"}, "ts": "2023-07-06 12:42:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01129", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:43:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01129"}, "ts": "2023-07-06 12:43:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16754786", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 12:43:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16754786", "type": "PubMed"}, "ts": "2023-07-06 12:43:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:43:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VTJ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:43:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VTJ3"}, "ts": "2023-07-06 12:43:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21883093", "type": "PubMed"}, "ts": "2023-07-06 12:43:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21883093", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 12:43:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D7N3-1"}, "ts": "2023-07-06 12:44:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D7N3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:44:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2MV58"}, "ts": "2023-07-06 12:44:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2MV58", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:44:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43007"}, "ts": "2023-07-06 12:44:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43007", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:45:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15438", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:45:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15438"}, "ts": "2023-07-06 12:45:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G03275SD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 12:45:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G03275SD"}, "ts": "2023-07-06 12:45:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00059", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:45:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00059"}, "ts": "2023-07-06 12:45:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6L6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:45:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6L6-1"}, "ts": "2023-07-06 12:45:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q71RJ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:45:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07737", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:45:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07737"}, "ts": "2023-07-06 12:45:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14703", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:46:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14703.600.600"}, "ts": "2023-07-06 12:46:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43252"}, "ts": "2023-07-06 12:47:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14195", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:47:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14195.518.518"}, "ts": "2023-07-06 12:47:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P46531.159.159"}, "ts": "2023-07-06 12:47:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46531", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:47:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z8F7"}, "ts": "2023-07-06 12:47:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z8F7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 12:48:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10773YW"}, "ts": "2023-07-06 12:48:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:48:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16070", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:48:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16070"}, "ts": "2023-07-06 12:48:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12771381", "type": "PubMed"}, "ts": "2023-07-06 12:48:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43497.649.649"}, "ts": "2023-07-06 12:48:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43497", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:48:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-06 12:48:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02030ZB"}, "ts": "2023-07-06 12:48:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06330RB"}, "ts": "2023-07-06 12:48:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-06 12:48:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-06 12:48:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13694XX"}, "ts": "2023-07-06 12:48:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15169WU"}, "ts": "2023-07-06 12:48:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20312EM"}, "ts": "2023-07-06 12:48:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-06 12:48:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23010ZW"}, "ts": "2023-07-06 12:48:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25418HZ"}, "ts": "2023-07-06 12:48:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25451PN"}, "ts": "2023-07-06 12:48:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33791AF"}, "ts": "2023-07-06 12:48:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37881RL"}, "ts": "2023-07-06 12:48:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39595FH"}, "ts": "2023-07-06 12:48:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44215PV"}, "ts": "2023-07-06 12:48:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46524LG"}, "ts": "2023-07-06 12:48:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47012YE"}, "ts": "2023-07-06 12:48:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47518TP"}, "ts": "2023-07-06 12:48:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-06 12:48:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53434XO"}, "ts": "2023-07-06 12:48:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-06 12:48:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12771381", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 12:48:43 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q91V88-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 12:49:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91V88-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 12:49:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63HM9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:49:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q63HM9.245.245"}, "ts": "2023-07-06 12:49:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10469", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:49:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q10469"}, "ts": "2023-07-06 12:49:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBI1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:50:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBI1"}, "ts": "2023-07-06 12:50:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49788"}, "ts": "2023-07-06 12:50:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49788", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:50:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A2Z4LIS9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:50:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A2Z4LIS9-1"}, "ts": "2023-07-06 12:50:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8838578", "type": "PubMed"}, "ts": "2023-07-06 12:50:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8838578", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 12:50:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q76M96", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:50:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CA5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:50:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q76M96"}, "ts": "2023-07-06 12:50:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47196"}, "ts": "2023-07-06 12:50:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08538"}, "ts": "2023-07-06 12:51:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08538", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:51:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G32227EH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 12:51:08 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G32227EH"}, "ts": "2023-07-06 12:51:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22635272", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 12:51:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22635272", "type": "PubMed"}, "ts": "2023-07-06 12:51:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G60660BN"}, "ts": "2023-07-06 12:52:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9Q368-1"}, "ts": "2023-07-06 12:52:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q368-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:52:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62266"}, "ts": "2023-07-06 12:52:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75390"}, "ts": "2023-07-06 12:52:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3LRZ1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:52:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3LRZ1-1"}, "ts": "2023-07-06 12:52:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M091-1"}, "ts": "2023-07-06 12:52:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M091-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:53:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 12:53:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "19453261"}, "ts": "2023-07-06 12:53:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00469", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:53:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00469.372.372"}, "ts": "2023-07-06 12:53:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UHD2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 12:53:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UHD2"}, "ts": "2023-07-06 12:53:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CIZ5"}, "ts": "2023-07-06 12:53:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CIZ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:53:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZ94"}, "ts": "2023-07-06 12:54:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZ94", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:54:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17450LT"}, "ts": "2023-07-06 12:54:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 12:54:24 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P18669", "cluster_type": "unselected"}, "ts": "2023-07-06 12:54:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18669", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 12:54:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18669", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 12:54:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F7EUU4-1"}, "ts": "2023-07-06 12:54:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F7EUU4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:54:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWP7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:54:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09486", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:54:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09486.116.116"}, "ts": "2023-07-06 12:54:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UWP7"}, "ts": "2023-07-06 12:54:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P62805.15.15"}, "ts": "2023-07-06 12:55:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62805", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:55:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "C0HLM6"}, "ts": "2023-07-06 12:55:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "C0HLM6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:55:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15104-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:55:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G32227EH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 12:56:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G32227EH"}, "ts": "2023-07-06 12:56:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ESQ7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:56:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9ESQ7.345.345"}, "ts": "2023-07-06 12:56:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02765", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:56:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02765.325.325"}, "ts": "2023-07-06 12:56:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29413899", "type": "PubMed"}, "ts": "2023-07-06 12:56:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29413899", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 12:56:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08670", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:57:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96T76", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 12:57:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96T76"}, "ts": "2023-07-06 12:57:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PWW0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 12:57:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9PWW0"}, "ts": "2023-07-06 12:57:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z5J4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:57:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z5J4.1091.1091"}, "ts": "2023-07-06 12:57:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 12:58:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2531896", "type": "PubMed"}, "ts": "2023-07-06 12:58:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2531896", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 12:58:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 12:58:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37837", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 12:58:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37837"}, "ts": "2023-07-06 12:58:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NVD6"}, "ts": "2023-07-06 12:58:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NVD6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 12:58:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXF6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 12:59:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXF6"}, "ts": "2023-07-06 12:59:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00653-1"}, "ts": "2023-07-06 12:59:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30011295", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 12:59:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30011295", "type": "PubMed"}, "ts": "2023-07-06 12:59:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z406", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 12:59:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z406.35.35"}, "ts": "2023-07-06 12:59:34 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-06 13:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-06 13:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 13:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-06 13:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-06 13:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-06 13:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27695"}, "ts": "2023-07-06 13:00:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27695", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:00:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8786132", "type": "PubMed"}, "ts": "2023-07-06 13:00:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8786132", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:00:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHK0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:00:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-06 13:00:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UHK0.487.487"}, "ts": "2023-07-06 13:00:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20354186", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:01:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20354186", "type": "PubMed"}, "ts": "2023-07-06 13:01:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04156"}, "ts": "2023-07-06 13:01:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04156", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:01:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IW41", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:01:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P996", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:01:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IW41"}, "ts": "2023-07-06 13:01:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20018762", "type": "PubMed"}, "ts": "2023-07-06 13:01:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20018762", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:01:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZM4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:01:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BZM4.113.113"}, "ts": "2023-07-06 13:01:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14843DJ"}, "ts": "2023-07-06 13:01:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G72544PU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 13:02:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G72544PU"}, "ts": "2023-07-06 13:02:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H8M1"}, "ts": "2023-07-06 13:02:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H8M1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:02:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94929"}, "ts": "2023-07-06 13:03:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94929", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:03:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G65020KU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 13:03:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G65020KU"}, "ts": "2023-07-06 13:03:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43252", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:03:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02686", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:03:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02686"}, "ts": "2023-07-06 13:03:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52789"}, "ts": "2023-07-06 13:03:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SNV9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:04:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5SNV9-1"}, "ts": "2023-07-06 13:04:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDV2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:04:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G10773YW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 13:04:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDV2"}, "ts": "2023-07-06 13:04:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLF7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:04:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLF7"}, "ts": "2023-07-06 13:04:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TC59", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 13:04:24 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8TC59", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 13:04:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14923.321.321"}, "ts": "2023-07-06 13:04:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:04:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14923", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:04:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZIA7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:04:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZIA7"}, "ts": "2023-07-06 13:04:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:04:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2780570", "type": "PubMed"}, "ts": "2023-07-06 13:04:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2780570", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:04:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60832-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:05:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60832-1"}, "ts": "2023-07-06 13:05:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14563", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:05:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14563.224.224"}, "ts": "2023-07-06 13:05:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q658N2.189.189"}, "ts": "2023-07-06 13:05:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q658N2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:05:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RK0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:05:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JIL4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:07:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JIL4"}, "ts": "2023-07-06 13:07:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16049014", "type": "PubMed"}, "ts": "2023-07-06 13:07:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16049014", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:07:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P47743.95.95"}, "ts": "2023-07-06 13:07:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47743", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:07:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12830-1"}, "ts": "2023-07-06 13:07:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12830-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:07:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPU3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:07:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UPU3.134.134"}, "ts": "2023-07-06 13:07:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4C4"}, "ts": "2023-07-06 13:07:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4C4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:07:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00533"}, "ts": "2023-07-06 13:07:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60660BN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 13:08:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28386024", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:08:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28386024", "type": "PubMed"}, "ts": "2023-07-06 13:08:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QUI6-1"}, "ts": "2023-07-06 13:08:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUI6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:08:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IX29"}, "ts": "2023-07-06 13:08:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IX29", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:08:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXP8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:08:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXP8"}, "ts": "2023-07-06 13:08:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULC0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:08:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9ULC0.165.165"}, "ts": "2023-07-06 13:08:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96LT4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:08:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96LT4-1"}, "ts": "2023-07-06 13:08:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62266", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:08:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RQ9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:08:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96RQ9.54.54"}, "ts": "2023-07-06 13:08:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07954", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:09:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q07954"}, "ts": "2023-07-06 13:09:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P57716-1"}, "ts": "2023-07-06 13:09:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57716-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:09:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EPB4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 13:09:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EPB4"}, "ts": "2023-07-06 13:09:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19838-1"}, "ts": "2023-07-06 13:10:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G22768VO"}, "ts": "2023-07-06 13:10:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08476", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:10:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08476"}, "ts": "2023-07-06 13:10:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53778", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:11:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53778"}, "ts": "2023-07-06 13:11:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34581723", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:11:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34581723", "type": "PubMed"}, "ts": "2023-07-06 13:11:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12526812", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:11:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12526812", "type": "PubMed"}, "ts": "2023-07-06 13:11:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:11:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55789", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:11:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55789"}, "ts": "2023-07-06 13:11:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q32P44"}, "ts": "2023-07-06 13:11:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14209"}, "ts": "2023-07-06 13:11:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q32P44", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:11:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15221008", "type": "PubMed"}, "ts": "2023-07-06 13:11:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15221008", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:11:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14618"}, "ts": "2023-07-06 13:12:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HB71", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:12:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HB71"}, "ts": "2023-07-06 13:12:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75882-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:12:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75882-1"}, "ts": "2023-07-06 13:12:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UK53"}, "ts": "2023-07-06 13:12:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UK53", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:12:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16706.707.707"}, "ts": "2023-07-06 13:13:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16706", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:13:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00338"}, "ts": "2023-07-06 13:13:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2H0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:13:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P2H0"}, "ts": "2023-07-06 13:13:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9339356", "type": "PubMed"}, "ts": "2023-07-06 13:13:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9339356", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:13:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G03275SD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 13:13:16 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G03275SD"}, "ts": "2023-07-06 13:13:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64605", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 13:13:16 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q64605", "cluster_type": "unselected"}, "ts": "2023-07-06 13:13:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51878", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:13:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51878"}, "ts": "2023-07-06 13:13:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2S2"}, "ts": "2023-07-06 13:13:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2S2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:13:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G5E8L3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:13:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G5E8L3-1"}, "ts": "2023-07-06 13:13:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64605", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-06 13:13:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00742-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:13:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00742-1"}, "ts": "2023-07-06 13:13:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHN6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:13:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UHN6.990.990"}, "ts": "2023-07-06 13:13:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21845-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:14:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21845-1"}, "ts": "2023-07-06 13:14:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NHS3.301.301"}, "ts": "2023-07-06 13:14:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NHS3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:14:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00653-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:14:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34615372", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:15:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34615372", "type": "PubMed"}, "ts": "2023-07-06 13:15:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2I0M4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:15:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2I0M4"}, "ts": "2023-07-06 13:15:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86SG5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:15:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86SG5"}, "ts": "2023-07-06 13:15:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62005"}, "ts": "2023-07-06 13:15:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62005", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:15:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0C7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:15:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:15:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9C0C7"}, "ts": "2023-07-06 13:15:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q810I2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:15:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q810I2"}, "ts": "2023-07-06 13:15:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30531"}, "ts": "2023-07-06 13:15:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 13:15:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34019948", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:15:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:15:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34019948", "type": "PubMed"}, "ts": "2023-07-06 13:15:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:15:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30379171", "type": "PubMed"}, "ts": "2023-07-06 13:15:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30379171", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:15:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:15:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30059200", "type": "PubMed"}, "ts": "2023-07-06 13:15:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30059200", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:15:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:15:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29351928", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:15:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29351928", "type": "PubMed"}, "ts": "2023-07-06 13:15:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70994MS"}, "ts": "2023-07-06 13:15:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13224"}, "ts": "2023-07-06 13:15:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:15:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31492838", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:15:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31492838", "type": "PubMed"}, "ts": "2023-07-06 13:15:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35289036", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:15:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "35289036", "type": "PubMed"}, "ts": "2023-07-06 13:15:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:15:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:15:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35254053", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:15:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "35254053", "type": "PubMed"}, "ts": "2023-07-06 13:15:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28657654", "type": "PubMed"}, "ts": "2023-07-06 13:15:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28657654", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:15:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:15:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80ZM8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:16:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80ZM8"}, "ts": "2023-07-06 13:16:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24268"}, "ts": "2023-07-06 13:16:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24268", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:16:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58397", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:17:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P58397.817.817"}, "ts": "2023-07-06 13:17:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8K7I4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:17:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A8K7I4.831.831"}, "ts": "2023-07-06 13:17:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-06 13:17:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G14843DJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 13:17:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02779-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:18:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:18:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02779-1"}, "ts": "2023-07-06 13:18:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BJX1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 13:18:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BJX1"}, "ts": "2023-07-06 13:18:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05387.33.33"}, "ts": "2023-07-06 13:18:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05387", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:18:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BP3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:18:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96BP3"}, "ts": "2023-07-06 13:18:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:19:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61249-1"}, "ts": "2023-07-06 13:19:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61249-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:19:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00264", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:19:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00264"}, "ts": "2023-07-06 13:19:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52789", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:20:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TB45", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:20:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TB45"}, "ts": "2023-07-06 13:20:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 13:20:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64863OF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 13:20:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64863OF"}, "ts": "2023-07-06 13:20:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10070.27.27"}, "ts": "2023-07-06 13:20:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10070", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:20:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28482-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:20:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28482-1"}, "ts": "2023-07-06 13:20:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6YBV0"}, "ts": "2023-07-06 13:21:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WVM6-1"}, "ts": "2023-07-06 13:21:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WVM6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:21:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51809", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 13:21:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51809"}, "ts": "2023-07-06 13:21:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10646609", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:21:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10646609", "type": "PubMed"}, "ts": "2023-07-06 13:21:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13258", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:21:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13258"}, "ts": "2023-07-06 13:21:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 13:22:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02338"}, "ts": "2023-07-06 13:22:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02338", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 13:22:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43290", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:22:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43290"}, "ts": "2023-07-06 13:22:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60888"}, "ts": "2023-07-06 13:23:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60888", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:23:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-06 13:23:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55107"}, "ts": "2023-07-06 13:23:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55107", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:23:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00533", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:23:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:24:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76071", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:24:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O76071"}, "ts": "2023-07-06 13:24:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BPX3.386.386"}, "ts": "2023-07-06 13:24:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BPX3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:24:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70441", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:24:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70441"}, "ts": "2023-07-06 13:24:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PH6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:25:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PH6"}, "ts": "2023-07-06 13:25:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6G9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:25:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6G9.67.67"}, "ts": "2023-07-06 13:25:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q641X2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:25:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q641X2.182.182"}, "ts": "2023-07-06 13:25:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19838-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:25:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WTN3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:26:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9WTN3.332.332"}, "ts": "2023-07-06 13:26:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91VR2-1"}, "ts": "2023-07-06 13:26:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91VR2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:26:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G22768VO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 13:26:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99538"}, "ts": "2023-07-06 13:27:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21613609", "type": "PubMed"}, "ts": "2023-07-06 13:27:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99538", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:27:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21613609", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:27:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:27:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96E35"}, "ts": "2023-07-06 13:27:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96E35", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:27:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95696", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:27:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95696.1055.1055"}, "ts": "2023-07-06 13:27:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7263664", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:27:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7263664", "type": "PubMed"}, "ts": "2023-07-06 13:27:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14209", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:27:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y508", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 13:27:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y508"}, "ts": "2023-07-06 13:27:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02952", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:27:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02952"}, "ts": "2023-07-06 13:27:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14618", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:28:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "C9J069"}, "ts": "2023-07-06 13:28:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "C9J069", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:28:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B3SHH9"}, "ts": "2023-07-06 13:28:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B3SHH9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:28:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01139"}, "ts": "2023-07-06 13:28:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01139", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:28:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00338", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:29:01 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8NAX2-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 13:29:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NAX2-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 13:29:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NAX2-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-06 13:29:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UK76-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:29:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UK76-1"}, "ts": "2023-07-06 13:29:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5H943"}, "ts": "2023-07-06 13:29:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9813014", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:29:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9813014", "type": "PubMed"}, "ts": "2023-07-06 13:29:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:30:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29122", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:30:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29122"}, "ts": "2023-07-06 13:30:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55157"}, "ts": "2023-07-06 13:30:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04637"}, "ts": "2023-07-06 13:30:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20031603", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:30:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20031603", "type": "PubMed"}, "ts": "2023-07-06 13:30:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98160", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:30:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:30:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P98160.2140.2140"}, "ts": "2023-07-06 13:30:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:31:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5F1.418.418"}, "ts": "2023-07-06 13:31:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5F1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:31:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:31:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68FQ2"}, "ts": "2023-07-06 13:32:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68FQ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:32:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "SULF1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "Performing Global Search"}, "ts": "2023-07-06 13:32:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 13:32:14 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "SULF1"}, "ts": "2023-07-06 13:32:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 13:32:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "SULF1", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=SULF1"}, "ts": "2023-07-06 13:32:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40933"}, "ts": "2023-07-06 13:32:15 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 13:32:17 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "fdd88e1572cad8f256a7d059f08b9bef", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 13:32:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "fdd88e1572cad8f256a7d059f08b9bef", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 13:32:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWU6-1"}, "ts": "2023-07-06 13:32:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWU6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:32:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-06 13:32:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-06 13:32:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-06 13:32:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-06 13:32:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-06 13:32:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-06 13:32:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-06 13:32:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48584BU"}, "ts": "2023-07-06 13:32:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72667IM"}, "ts": "2023-07-06 13:32:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-06 13:32:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46940"}, "ts": "2023-07-06 13:33:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46940", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:33:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96LA9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:33:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96LA9"}, "ts": "2023-07-06 13:33:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1695146", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:33:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00912UN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 13:33:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1695146", "type": "PubMed"}, "ts": "2023-07-06 13:33:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V7T6"}, "ts": "2023-07-06 13:34:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V7T6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 13:34:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70447"}, "ts": "2023-07-06 13:34:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70447", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:34:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 13:34:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60926LS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 13:34:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G60926LS"}, "ts": "2023-07-06 13:35:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56194CX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 13:35:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56194CX"}, "ts": "2023-07-06 13:35:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00051MO"}, "ts": "2023-07-06 13:35:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00051MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 13:35:45 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 13:35:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "fdd88e1572cad8f256a7d059f08b9bef", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 13:35:45 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "fdd88e1572cad8f256a7d059f08b9bef", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 13:35:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PF15"}, "ts": "2023-07-06 13:35:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PF15", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 13:35:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 13:35:53 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "SULF1"}, "ts": "2023-07-06 13:35:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "SULF1", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=SULF1"}, "ts": "2023-07-06 13:35:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11719503", "type": "PubMed"}, "ts": "2023-07-06 13:36:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11719503", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:36:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68402"}, "ts": "2023-07-06 13:36:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "SULF1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "Performing Global Search"}, "ts": "2023-07-06 13:37:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 13:37:02 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "SULF1"}, "ts": "2023-07-06 13:37:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 13:37:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "SULF1", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=SULF1"}, "ts": "2023-07-06 13:37:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6YBV0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:37:03 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 13:37:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "acc928a7f44f3371e31b33a392f200fc", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 13:37:08 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "acc928a7f44f3371e31b33a392f200fc", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 13:37:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "acc928a7f44f3371e31b33a392f200fc", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 13:37:17 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "acc928a7f44f3371e31b33a392f200fc", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": [{"id": "by_ptm", "operator": "OR", "selected": ["O-Glycosylation reported"]}]}, "ts": "2023-07-06 13:37:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "sulf1", "user": "Undecided", "type": "user", "page": "protein-list", "message": "Performing Global Search"}, "ts": "2023-07-06 13:37:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 13:37:28 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "sulf1"}, "ts": "2023-07-06 13:37:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 13:37:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "sulf1", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=sulf1"}, "ts": "2023-07-06 13:37:28 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 13:37:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "44bbff67a4cb70c5464ffa80d4b7c935", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 13:37:30 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "44bbff67a4cb70c5464ffa80d4b7c935", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 13:37:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NBJ4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:37:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29716528", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:37:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NBJ4-1"}, "ts": "2023-07-06 13:37:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29716528", "type": "PubMed"}, "ts": "2023-07-06 13:37:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWU6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:37:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWU6-1"}, "ts": "2023-07-06 13:37:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21588"}, "ts": "2023-07-06 13:37:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96ME7"}, "ts": "2023-07-06 13:37:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VCD7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 13:37:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VCD7"}, "ts": "2023-07-06 13:37:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96ME7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:37:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:38:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94813"}, "ts": "2023-07-06 13:38:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94813", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:38:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07912-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:38:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q07912-1"}, "ts": "2023-07-06 13:38:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "g00052mo"}, "ts": "2023-07-06 13:39:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "g00052mo", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 13:39:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "privacy-policy", "message": "page access"}, "ts": "2023-07-06 13:39:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "privacy-policy", "message": "page access"}, "ts": "2023-07-06 13:39:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20749"}, "ts": "2023-07-06 13:39:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20749", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 13:39:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IU60", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 13:40:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IU60"}, "ts": "2023-07-06 13:40:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6Y1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:40:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17682054", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:41:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17682054", "type": "PubMed"}, "ts": "2023-07-06 13:41:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V9R8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:41:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V9R8-1"}, "ts": "2023-07-06 13:41:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GPC5", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-06 13:41:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 13:41:42 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "GPC5"}, "ts": "2023-07-06 13:41:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 13:41:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GPC5", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=GPC5"}, "ts": "2023-07-06 13:41:42 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 13:41:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "52b1d246ed6d57c0378dd8667d4d6748", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 13:41:44 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "52b1d246ed6d57c0378dd8667d4d6748", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 13:41:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78333-1"}, "ts": "2023-07-06 13:41:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78333-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:41:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13073.58.58"}, "ts": "2023-07-06 13:41:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13073", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:41:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11959841", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:42:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11959841", "type": "PubMed"}, "ts": "2023-07-06 13:42:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94901", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:42:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94901.324.324"}, "ts": "2023-07-06 13:42:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15911.1134.1134"}, "ts": "2023-07-06 13:42:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15911", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:42:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:42:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VXI9"}, "ts": "2023-07-06 13:42:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VXI9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:42:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HA82"}, "ts": "2023-07-06 13:42:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HA82", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:42:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52701", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:42:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P52701.87.87"}, "ts": "2023-07-06 13:42:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5H943", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:43:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40225"}, "ts": "2023-07-06 13:43:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z127", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:43:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z127"}, "ts": "2023-07-06 13:43:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91VJ4"}, "ts": "2023-07-06 13:43:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G73390OW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 13:43:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91VJ4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:43:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00441"}, "ts": "2023-07-06 13:43:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G73390OW"}, "ts": "2023-07-06 13:43:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06280"}, "ts": "2023-07-06 13:43:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLN9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:43:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:43:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q922Q8"}, "ts": "2023-07-06 13:43:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q922Q8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:43:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 13:43:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Sec61B", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-06 13:43:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 13:43:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 13:43:53 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Sec61B"}, "ts": "2023-07-06 13:43:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Sec61B", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Sec61B"}, "ts": "2023-07-06 13:43:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZU86"}, "ts": "2023-07-06 13:43:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZU86", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:44:00 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 13:44:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ed01100e172fe21db1f5a3192dda86a9", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 13:44:01 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "ed01100e172fe21db1f5a3192dda86a9", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 13:44:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60468-1"}, "ts": "2023-07-06 13:44:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60468-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:44:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75116.414.414"}, "ts": "2023-07-06 13:44:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75116", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:44:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01877.205.205"}, "ts": "2023-07-06 13:44:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01877", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:44:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47743", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:45:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07288VN"}, "ts": "2023-07-06 13:45:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07288VN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 13:45:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P47743.95.95"}, "ts": "2023-07-06 13:45:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04899.125.125"}, "ts": "2023-07-06 13:45:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04899", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:45:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CW9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:45:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96CW9.158.158"}, "ts": "2023-07-06 13:45:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28660"}, "ts": "2023-07-06 13:46:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09874"}, "ts": "2023-07-06 13:46:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09874", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:46:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33993-1"}, "ts": "2023-07-06 13:46:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04637", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:46:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21845"}, "ts": "2023-07-06 13:46:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21845", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:46:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G50737AO"}, "ts": "2023-07-06 13:46:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G50737AO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 13:46:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15640247", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:47:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15640247", "type": "PubMed"}, "ts": "2023-07-06 13:47:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60443", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 13:47:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L4P6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:47:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7L4P6"}, "ts": "2023-07-06 13:47:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60443"}, "ts": "2023-07-06 13:47:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CRB6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:48:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CRB6-1"}, "ts": "2023-07-06 13:48:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99574", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:48:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99574.401.401"}, "ts": "2023-07-06 13:48:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7L5Y1"}, "ts": "2023-07-06 13:48:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:48:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L5Y1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:48:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P07237.357.357"}, "ts": "2023-07-06 13:49:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07237", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:49:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NXC5"}, "ts": "2023-07-06 13:49:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NXC5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:49:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BRH0-1"}, "ts": "2023-07-06 13:49:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BRH0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:49:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95785", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:49:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95785"}, "ts": "2023-07-06 13:49:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NS40", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:49:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05783", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:50:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05783"}, "ts": "2023-07-06 13:50:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8617735", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:50:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8617735", "type": "PubMed"}, "ts": "2023-07-06 13:50:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06312", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:50:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06312"}, "ts": "2023-07-06 13:50:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20060", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:50:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20060"}, "ts": "2023-07-06 13:50:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2S2"}, "ts": "2023-07-06 13:50:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2S2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:50:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26358-1"}, "ts": "2023-07-06 13:51:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26358-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:51:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 13:51:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43363", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 13:51:27 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P43363", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 13:51:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G75097UM"}, "ts": "2023-07-06 13:51:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G75097UM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 13:51:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G45504EY"}, "ts": "2023-07-06 13:52:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G45504EY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 13:52:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68402", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:52:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07001", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:52:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q07001"}, "ts": "2023-07-06 13:52:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10675319", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:52:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10675319", "type": "PubMed"}, "ts": "2023-07-06 13:52:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2AVB0"}, "ts": "2023-07-06 13:52:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AVB0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:52:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00441", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:53:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZUI0"}, "ts": "2023-07-06 13:53:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZUI0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:53:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98161"}, "ts": "2023-07-06 13:53:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98073"}, "ts": "2023-07-06 13:53:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21588", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:53:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q75V66"}, "ts": "2023-07-06 13:53:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q75V66", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 13:53:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G72729HN"}, "ts": "2023-07-06 13:53:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G72729HN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 13:53:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H5I1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:54:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H5I1"}, "ts": "2023-07-06 13:54:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05279MG"}, "ts": "2023-07-06 13:55:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96ST3.287.287"}, "ts": "2023-07-06 13:55:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96ST3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:55:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06280", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:55:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:56:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92563", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:56:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92563"}, "ts": "2023-07-06 13:56:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9C0B5"}, "ts": "2023-07-06 13:56:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0B5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:56:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6M7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:56:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6M7"}, "ts": "2023-07-06 13:56:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VDN2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:56:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VDN2"}, "ts": "2023-07-06 13:56:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16402"}, "ts": "2023-07-06 13:56:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16402", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:56:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15596", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:57:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15596"}, "ts": "2023-07-06 13:57:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59533", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:57:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59533"}, "ts": "2023-07-06 13:57:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14151-1"}, "ts": "2023-07-06 13:57:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6K5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:57:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96S94", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:57:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96S94"}, "ts": "2023-07-06 13:57:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14923", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:57:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14923.321.321"}, "ts": "2023-07-06 13:57:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56194CX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 13:58:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56194CX"}, "ts": "2023-07-06 13:58:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G37158XG"}, "ts": "2023-07-06 13:58:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G37158XG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 13:58:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UVM3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 13:58:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UVM3.99.99"}, "ts": "2023-07-06 13:58:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29656342", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:59:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29656342", "type": "PubMed"}, "ts": "2023-07-06 13:59:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 13:59:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CRB6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 13:59:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CRB6-1"}, "ts": "2023-07-06 13:59:56 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-06 14:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-06 14:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 14:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-06 14:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-06 14:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-06 14:00:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NWM3.267.267"}, "ts": "2023-07-06 14:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NWM3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:00:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96PB1.565.565"}, "ts": "2023-07-06 14:00:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PB1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:00:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBU2"}, "ts": "2023-07-06 14:00:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBU2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:00:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NSD9"}, "ts": "2023-07-06 14:00:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NSD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:00:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27601583", "type": "PubMed"}, "ts": "2023-07-06 14:00:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27601583", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 14:00:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:00:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14513"}, "ts": "2023-07-06 14:00:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14513", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:01:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGT1"}, "ts": "2023-07-06 14:01:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGT1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:01:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60033FS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 14:01:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G60033FS"}, "ts": "2023-07-06 14:01:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95528"}, "ts": "2023-07-06 14:01:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95528", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:01:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47929", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:01:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47929"}, "ts": "2023-07-06 14:01:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WVC1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 14:01:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WVC1"}, "ts": "2023-07-06 14:01:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28482-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:01:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28482-1"}, "ts": "2023-07-06 14:01:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61218"}, "ts": "2023-07-06 14:02:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61218", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 14:02:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33993-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:02:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EPC6-1"}, "ts": "2023-07-06 14:02:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EPC6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:02:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97797-1"}, "ts": "2023-07-06 14:02:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80V53"}, "ts": "2023-07-06 14:03:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80V53", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:03:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C0L4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:03:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7LBC6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:03:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7LBC6.420.420"}, "ts": "2023-07-06 14:03:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M753-1"}, "ts": "2023-07-06 14:03:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M753-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:03:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "how-to-cite", "message": "page access"}, "ts": "2023-07-06 14:03:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "how-to-cite", "message": "page access"}, "ts": "2023-07-06 14:03:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C0L4"}, "ts": "2023-07-06 14:03:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15760897", "type": "PubMed"}, "ts": "2023-07-06 14:03:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15760897", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 14:03:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7RTM1"}, "ts": "2023-07-06 14:03:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:03:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 14:04:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "1278112"}, "ts": "2023-07-06 14:04:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 14:04:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22566623", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 14:04:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22566623", "type": "PubMed"}, "ts": "2023-07-06 14:04:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05556.520.520"}, "ts": "2023-07-06 14:04:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05556", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:04:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23396"}, "ts": "2023-07-06 14:05:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:05:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55786"}, "ts": "2023-07-06 14:05:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55786", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:05:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYR9"}, "ts": "2023-07-06 14:05:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYR9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:05:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ER39"}, "ts": "2023-07-06 14:06:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ER39", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:06:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59535"}, "ts": "2023-07-06 14:06:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59535", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:06:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:06:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q811U4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:07:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q811U4-1"}, "ts": "2023-07-06 14:07:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 14:07:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G73390OW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 14:07:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G73390OW"}, "ts": "2023-07-06 14:07:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43852"}, "ts": "2023-07-06 14:08:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43852", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:08:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V631-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:08:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V631-1"}, "ts": "2023-07-06 14:08:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JY18", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:08:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JY18"}, "ts": "2023-07-06 14:08:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P28799.532.532"}, "ts": "2023-07-06 14:09:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28799", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:09:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98161", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:09:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98073", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:09:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G65020KU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 14:09:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 14:09:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G65020KU"}, "ts": "2023-07-06 14:09:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G27391WQ"}, "ts": "2023-07-06 14:09:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15205"}, "ts": "2023-07-06 14:09:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "407930", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 14:09:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "407930", "type": "PubMed"}, "ts": "2023-07-06 14:09:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z4Q2-1"}, "ts": "2023-07-06 14:10:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05279MG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 14:11:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YZ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:11:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9806549", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 14:11:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9806549", "type": "PubMed"}, "ts": "2023-07-06 14:11:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23083"}, "ts": "2023-07-06 14:11:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23083", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:11:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95992", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:11:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95992.10.10"}, "ts": "2023-07-06 14:11:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G89354EL"}, "ts": "2023-07-06 14:12:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G89354EL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 14:12:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q93034", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:12:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q93034.730.730"}, "ts": "2023-07-06 14:12:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 14:12:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99627", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 14:12:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99627"}, "ts": "2023-07-06 14:12:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2Y0W8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:12:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2Y0W8"}, "ts": "2023-07-06 14:12:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14151-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:13:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5FVQ0-1"}, "ts": "2023-07-06 14:13:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5FVQ0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:13:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11150", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:13:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11150"}, "ts": "2023-07-06 14:13:58 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G75097UM"}, "ts": "2023-07-06 14:14:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TER0"}, "ts": "2023-07-06 14:14:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TER0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:14:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G75097UM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 14:14:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTU9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:14:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7RTU9"}, "ts": "2023-07-06 14:14:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26038"}, "ts": "2023-07-06 14:14:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01959"}, "ts": "2023-07-06 14:14:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CRB6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:14:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CRB6-1"}, "ts": "2023-07-06 14:14:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62893"}, "ts": "2023-07-06 14:14:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62893", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 14:14:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15293", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:15:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15293"}, "ts": "2023-07-06 14:15:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19823"}, "ts": "2023-07-06 14:15:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19823", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:15:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15596", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:15:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15596.746.746"}, "ts": "2023-07-06 14:15:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UFF7-1"}, "ts": "2023-07-06 14:15:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q4LE39.246.246"}, "ts": "2023-07-06 14:15:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4LE39", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:15:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UFF7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:15:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y279-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:15:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y279-1"}, "ts": "2023-07-06 14:15:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C025-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:15:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C025-1"}, "ts": "2023-07-06 14:15:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19417006", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 14:16:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19417006", "type": "PubMed"}, "ts": "2023-07-06 14:16:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G77000EG"}, "ts": "2023-07-06 14:17:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 14:17:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G77000EG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 14:17:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77000EG"}, "ts": "2023-07-06 14:17:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34953RY"}, "ts": "2023-07-06 14:17:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67631MS"}, "ts": "2023-07-06 14:17:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17388RM"}, "ts": "2023-07-06 14:17:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62635-1"}, "ts": "2023-07-06 14:17:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62635-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:17:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02856QE"}, "ts": "2023-07-06 14:17:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01351CD"}, "ts": "2023-07-06 14:17:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00219VH"}, "ts": "2023-07-06 14:17:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04908IA"}, "ts": "2023-07-06 14:17:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10013HB"}, "ts": "2023-07-06 14:17:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06116KH"}, "ts": "2023-07-06 14:17:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12035CL"}, "ts": "2023-07-06 14:17:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12678YV"}, "ts": "2023-07-06 14:17:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12679QG"}, "ts": "2023-07-06 14:17:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16831PL"}, "ts": "2023-07-06 14:17:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17236TT"}, "ts": "2023-07-06 14:17:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19399OS"}, "ts": "2023-07-06 14:17:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20165PS"}, "ts": "2023-07-06 14:17:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22355FZ"}, "ts": "2023-07-06 14:17:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23755RZ"}, "ts": "2023-07-06 14:17:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23990GP"}, "ts": "2023-07-06 14:17:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25340RJ"}, "ts": "2023-07-06 14:17:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26724PP"}, "ts": "2023-07-06 14:17:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26777KI"}, "ts": "2023-07-06 14:17:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29166US"}, "ts": "2023-07-06 14:17:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AEV7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:17:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A2AEV7.357.357"}, "ts": "2023-07-06 14:17:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08722"}, "ts": "2023-07-06 14:17:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "MUC2", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-06 14:17:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 14:17:36 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "MUC2"}, "ts": "2023-07-06 14:17:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 14:17:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "MUC2", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=MUC2"}, "ts": "2023-07-06 14:17:36 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 14:17:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "a3326c5906934157b826d35dd9688f73", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 14:17:37 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "a3326c5906934157b826d35dd9688f73", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 14:17:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02817-1"}, "ts": "2023-07-06 14:17:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02817-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:17:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-06 14:17:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00035MO"}, "ts": "2023-07-06 14:17:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03172PR"}, "ts": "2023-07-06 14:17:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03674DU"}, "ts": "2023-07-06 14:17:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03494YC"}, "ts": "2023-07-06 14:17:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07932PU"}, "ts": "2023-07-06 14:17:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10256JP"}, "ts": "2023-07-06 14:17:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14260UH"}, "ts": "2023-07-06 14:17:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17810KS"}, "ts": "2023-07-06 14:17:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23438NR"}, "ts": "2023-07-06 14:17:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23870PO"}, "ts": "2023-07-06 14:17:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25780HH"}, "ts": "2023-07-06 14:17:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26493RP"}, "ts": "2023-07-06 14:17:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26915XM"}, "ts": "2023-07-06 14:17:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27726WH"}, "ts": "2023-07-06 14:17:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29025YS"}, "ts": "2023-07-06 14:17:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29931IJ"}, "ts": "2023-07-06 14:17:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30304IT"}, "ts": "2023-07-06 14:17:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31685JQ"}, "ts": "2023-07-06 14:17:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21416545", "type": "PubMed"}, "ts": "2023-07-06 14:18:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21416545", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 14:18:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:18:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62631"}, "ts": "2023-07-06 14:18:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62631", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:18:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 14:18:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:18:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95456", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:18:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95456"}, "ts": "2023-07-06 14:18:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29892279", "type": "PubMed"}, "ts": "2023-07-06 14:18:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29892279", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 14:18:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UK61", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:18:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UK61.1543.1543"}, "ts": "2023-07-06 14:18:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28482-1"}, "ts": "2023-07-06 14:18:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28482-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:18:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G71013KY"}, "ts": "2023-07-06 14:18:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97797-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:18:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "070250", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-06 14:19:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 14:19:12 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "070250"}, "ts": "2023-07-06 14:19:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "070250", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=070250"}, "ts": "2023-07-06 14:19:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTW8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:19:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70250", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Performing Global Search"}, "ts": "2023-07-06 14:19:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 14:19:20 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "O70250"}, "ts": "2023-07-06 14:19:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70250", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=O70250"}, "ts": "2023-07-06 14:19:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 14:19:37 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 14:19:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UL15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:19:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:19:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UL15"}, "ts": "2023-07-06 14:19:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21589", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 14:20:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21589"}, "ts": "2023-07-06 14:20:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14831"}, "ts": "2023-07-06 14:20:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14831", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:20:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QXU9-1"}, "ts": "2023-07-06 14:20:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QXU9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:20:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16186", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:20:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16186.211.211"}, "ts": "2023-07-06 14:20:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1372507", "type": "PubMed"}, "ts": "2023-07-06 14:20:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1372507", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 14:20:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3A2"}, "ts": "2023-07-06 14:21:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3A2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 14:21:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49739MP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 14:21:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 14:21:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49739MP"}, "ts": "2023-07-06 14:21:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95155"}, "ts": "2023-07-06 14:21:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95155", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:21:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61334IA"}, "ts": "2023-07-06 14:22:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-06 14:22:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14975"}, "ts": "2023-07-06 14:22:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H8Y8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:22:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H8Y8.225.225"}, "ts": "2023-07-06 14:22:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z5L9"}, "ts": "2023-07-06 14:22:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFL0"}, "ts": "2023-07-06 14:23:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZQ58.299.299"}, "ts": "2023-07-06 14:23:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZQ58", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:23:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94516KE"}, "ts": "2023-07-06 14:24:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99819"}, "ts": "2023-07-06 14:24:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60885", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:24:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60885.658.658"}, "ts": "2023-07-06 14:24:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99819", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:24:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08721"}, "ts": "2023-07-06 14:24:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VV63.174.174"}, "ts": "2023-07-06 14:25:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VV63", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:25:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G27391WQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 14:25:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12259"}, "ts": "2023-07-06 14:25:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15205", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:25:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15265687", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 14:25:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15265687", "type": "PubMed"}, "ts": "2023-07-06 14:25:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "static", "message": "page access"}, "ts": "2023-07-06 14:25:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N300", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 14:26:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 14:26:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N300"}, "ts": "2023-07-06 14:26:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27806294", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 14:26:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H3G5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:26:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27806294", "type": "PubMed"}, "ts": "2023-07-06 14:26:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H3G5.81.81"}, "ts": "2023-07-06 14:26:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:27:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H4E7-1"}, "ts": "2023-07-06 14:27:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H4E7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:27:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "1631559"}, "ts": "2023-07-06 14:27:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20759", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:27:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20759"}, "ts": "2023-07-06 14:27:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:27:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N6F7"}, "ts": "2023-07-06 14:27:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N6F7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:27:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00738-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:27:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00738-1"}, "ts": "2023-07-06 14:27:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:28:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46781"}, "ts": "2023-07-06 14:28:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46781", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:28:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 14:28:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K4J6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:28:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8K4J6.358.358"}, "ts": "2023-07-06 14:28:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G23863VK"}, "ts": "2023-07-06 14:28:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:29:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P055"}, "ts": "2023-07-06 14:29:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P055", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:29:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 14:29:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35008409", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 14:29:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "35008409", "type": "PubMed"}, "ts": "2023-07-06 14:29:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y4B6.823.823"}, "ts": "2023-07-06 14:29:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4B6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:29:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04003"}, "ts": "2023-07-06 14:29:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04003", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:29:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96LA9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:29:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96LA9"}, "ts": "2023-07-06 14:29:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26038", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:30:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23511"}, "ts": "2023-07-06 14:30:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16076902", "type": "PubMed"}, "ts": "2023-07-06 14:30:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16076902", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 14:30:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01959", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:30:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03135-1"}, "ts": "2023-07-06 14:31:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RSH2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:31:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RSH2"}, "ts": "2023-07-06 14:31:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BT25"}, "ts": "2023-07-06 14:31:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BT25", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:31:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03137", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:31:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q03137.67.67"}, "ts": "2023-07-06 14:31:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:31:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G50045TK"}, "ts": "2023-07-06 14:31:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19491", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:32:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19491"}, "ts": "2023-07-06 14:32:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQX6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:32:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NQX6.85.85"}, "ts": "2023-07-06 14:32:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9C0C2"}, "ts": "2023-07-06 14:32:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0C2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:32:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NG11.49.49"}, "ts": "2023-07-06 14:32:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NG11", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:32:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NA56"}, "ts": "2023-07-06 14:32:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NA56", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:32:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39447", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:32:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P39447"}, "ts": "2023-07-06 14:32:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:33:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04229", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:33:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04229"}, "ts": "2023-07-06 14:33:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07969-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:33:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:33:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q07969-1"}, "ts": "2023-07-06 14:33:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08722", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:33:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02652", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:33:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02652"}, "ts": "2023-07-06 14:33:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02778", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:34:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02778"}, "ts": "2023-07-06 14:34:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P179", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:34:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P179"}, "ts": "2023-07-06 14:34:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXH1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:34:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UXH1"}, "ts": "2023-07-06 14:34:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P1P5.168.168"}, "ts": "2023-07-06 14:35:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P1P5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:35:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15147-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:35:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15147-1"}, "ts": "2023-07-06 14:35:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51610", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:35:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51610.262.262"}, "ts": "2023-07-06 14:35:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9920888", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 14:35:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9920888", "type": "PubMed"}, "ts": "2023-07-06 14:35:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61334IA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 14:35:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DTC2-1"}, "ts": "2023-07-06 14:35:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DTC2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:35:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKL3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:35:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UKL3.809.809"}, "ts": "2023-07-06 14:35:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96LC7"}, "ts": "2023-07-06 14:35:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96LC7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:36:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBM8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:36:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBM8-1"}, "ts": "2023-07-06 14:36:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ERH7"}, "ts": "2023-07-06 14:36:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ERH7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 14:36:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12081"}, "ts": "2023-07-06 14:36:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12081", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:36:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91VR2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:37:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91VR2-1"}, "ts": "2023-07-06 14:37:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13133.47.47"}, "ts": "2023-07-06 14:37:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11365AH"}, "ts": "2023-07-06 14:37:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13133", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:37:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:37:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99LJ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:37:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99LJ1"}, "ts": "2023-07-06 14:37:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16566", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:37:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16566"}, "ts": "2023-07-06 14:37:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9C0F0.1040.1040"}, "ts": "2023-07-06 14:37:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0F0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:37:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29692", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:37:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29692"}, "ts": "2023-07-06 14:37:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57321FI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 14:38:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14975", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:38:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 14:38:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24207126", "type": "PubMed"}, "ts": "2023-07-06 14:38:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24207126", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 14:38:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TMQ7-1"}, "ts": "2023-07-06 14:38:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TMQ7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:38:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99865", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:39:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99865"}, "ts": "2023-07-06 14:39:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61606", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 14:39:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61606"}, "ts": "2023-07-06 14:39:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NB16"}, "ts": "2023-07-06 14:39:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NB16", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 14:39:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08721", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:40:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UNW8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:40:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UNW8"}, "ts": "2023-07-06 14:40:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TQI7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:40:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3TQI7-1"}, "ts": "2023-07-06 14:40:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46940"}, "ts": "2023-07-06 14:40:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46940", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:40:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2T4.154.154"}, "ts": "2023-07-06 14:40:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2T4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:40:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06312"}, "ts": "2023-07-06 14:41:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06312", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:41:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:41:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYZ8"}, "ts": "2023-07-06 14:41:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYZ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:41:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00533-1"}, "ts": "2023-07-06 14:41:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16612"}, "ts": "2023-07-06 14:41:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16612", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:41:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16650"}, "ts": "2023-07-06 14:41:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21596310", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 14:41:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21596310", "type": "PubMed"}, "ts": "2023-07-06 14:41:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21817", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:42:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P21817.4864.4864"}, "ts": "2023-07-06 14:42:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35225"}, "ts": "2023-07-06 14:42:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35225", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:42:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95819.826.826"}, "ts": "2023-07-06 14:42:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95819", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:42:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14923.321.321"}, "ts": "2023-07-06 14:42:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14923", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:42:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14639-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 14:43:13 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O14639-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 14:43:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29268", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:43:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29268"}, "ts": "2023-07-06 14:43:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17208591", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 14:43:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98153"}, "ts": "2023-07-06 14:43:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17208591", "type": "PubMed"}, "ts": "2023-07-06 14:43:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95407.272.272"}, "ts": "2023-07-06 14:44:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95407", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:44:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G23863VK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 14:44:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16656"}, "ts": "2023-07-06 14:44:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HC78", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:44:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HC78"}, "ts": "2023-07-06 14:44:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08173"}, "ts": "2023-07-06 14:44:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35111"}, "ts": "2023-07-06 14:45:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35111", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:45:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43852", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:45:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:45:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43852.131.131"}, "ts": "2023-07-06 14:45:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLC8"}, "ts": "2023-07-06 14:45:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLC8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:45:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGP4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:46:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:46:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15654", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:46:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15654"}, "ts": "2023-07-06 14:46:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UGP4.233.233"}, "ts": "2023-07-06 14:46:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23511", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:46:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NX52-1"}, "ts": "2023-07-06 14:46:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NX52-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:46:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5JSL3.83.83"}, "ts": "2023-07-06 14:46:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JSL3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:46:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 14:46:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99819"}, "ts": "2023-07-06 14:46:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWA0"}, "ts": "2023-07-06 14:46:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99819", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:46:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWA0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:46:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03135-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:47:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q09028"}, "ts": "2023-07-06 14:47:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09028", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:47:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G50045TK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 14:47:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10992504", "type": "PubMed"}, "ts": "2023-07-06 14:48:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10992504", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 14:48:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16380466", "type": "PubMed"}, "ts": "2023-07-06 14:48:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16380466", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 14:48:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16378626", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 14:48:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16378626", "type": "PubMed"}, "ts": "2023-07-06 14:48:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1384323", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 14:48:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1384323", "type": "PubMed"}, "ts": "2023-07-06 14:48:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:49:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06211", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:49:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06211"}, "ts": "2023-07-06 14:49:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JK4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:49:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96JK4"}, "ts": "2023-07-06 14:49:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N370-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:50:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N370-1"}, "ts": "2023-07-06 14:50:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JUE9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 14:50:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JUE9"}, "ts": "2023-07-06 14:50:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30082"}, "ts": "2023-07-06 14:50:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2I0M4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:50:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2I0M4"}, "ts": "2023-07-06 14:50:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09466-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:50:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09466-1.81.81"}, "ts": "2023-07-06 14:50:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2A9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:50:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2A9"}, "ts": "2023-07-06 14:50:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-06 14:50:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P21860.104.104"}, "ts": "2023-07-06 14:50:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21860", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:50:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BVW0-1"}, "ts": "2023-07-06 14:51:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BVW0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:51:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-06 14:51:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G95678HJ"}, "ts": "2023-07-06 14:51:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G95678HJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 14:51:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07392QY"}, "ts": "2023-07-06 14:51:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DCF9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 14:51:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DCF9"}, "ts": "2023-07-06 14:51:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A4D2H0.427.427"}, "ts": "2023-07-06 14:51:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A4D2H0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:51:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O09044-1"}, "ts": "2023-07-06 14:51:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O09044-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:51:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12023509", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 14:51:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12023509", "type": "PubMed"}, "ts": "2023-07-06 14:51:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D7P3-1"}, "ts": "2023-07-06 14:52:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D7P3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:52:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BWY2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 14:52:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BWY2"}, "ts": "2023-07-06 14:52:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-06 14:53:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TF68"}, "ts": "2023-07-06 14:53:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P31350.44.44"}, "ts": "2023-07-06 14:53:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31350", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:53:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TF68", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:53:51 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000030", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-06 14:53:56 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000030", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-06 14:53:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000030", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-06 14:53:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-06 14:53:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99988", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:54:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99988.44.44"}, "ts": "2023-07-06 14:54:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49368", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:54:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49368"}, "ts": "2023-07-06 14:54:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UHR5.257.257"}, "ts": "2023-07-06 14:54:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHR5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:54:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHR5", "user": "Undecided", "type": "error", "page": "Siteview", "message": "Network error. Site Detail api call. Mozilla/5.0 (Windows NT 6.1; WOW64) AppleWebKit/534  (KHTML, like Gecko) BingPreview/1.0b"}, "ts": "2023-07-06 14:54:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15305", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:54:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15305"}, "ts": "2023-07-06 14:54:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 14:55:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08514.46.46"}, "ts": "2023-07-06 14:55:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08514", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:55:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BWV1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 14:55:17 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9BWV1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 14:55:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01011", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:55:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01011.271.271"}, "ts": "2023-07-06 14:55:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64270", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:55:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64270"}, "ts": "2023-07-06 14:55:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JP9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 14:55:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51650-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:55:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51650-1"}, "ts": "2023-07-06 14:55:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96JP9"}, "ts": "2023-07-06 14:55:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13191.141.141"}, "ts": "2023-07-06 14:56:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13191", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:56:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TEA6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:56:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5TEA6.406.406"}, "ts": "2023-07-06 14:56:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11276", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:56:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11276.528.528"}, "ts": "2023-07-06 14:56:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75352"}, "ts": "2023-07-06 14:56:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "license.html", "message": "page access"}, "ts": "2023-07-06 14:56:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NB14", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 14:57:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NB14"}, "ts": "2023-07-06 14:57:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14738", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:57:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14738.89.89"}, "ts": "2023-07-06 14:57:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00533-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:57:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16650", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:57:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22003", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:57:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22003"}, "ts": "2023-07-06 14:57:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91VR2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:57:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91VR2-1"}, "ts": "2023-07-06 14:57:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HCD5.395.395"}, "ts": "2023-07-06 14:57:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCD5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 14:57:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G41352UL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 14:58:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G41352UL"}, "ts": "2023-07-06 14:58:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94772"}, "ts": "2023-07-06 14:59:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94772", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:59:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96BP3"}, "ts": "2023-07-06 14:59:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98153", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:59:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BP3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 14:59:46 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-06 15:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-06 15:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 15:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-06 15:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-06 15:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-06 15:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:00:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q923T9-1"}, "ts": "2023-07-06 15:00:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q923T9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:00:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZPE2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:00:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZPE2"}, "ts": "2023-07-06 15:00:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RZB0"}, "ts": "2023-07-06 15:00:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RZB0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 15:00:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02311IE"}, "ts": "2023-07-06 15:00:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16656", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:00:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13485"}, "ts": "2023-07-06 15:00:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13485", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:00:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:00:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12719377", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:00:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12719377", "type": "PubMed"}, "ts": "2023-07-06 15:00:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08173", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:00:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5G0.395.395"}, "ts": "2023-07-06 15:01:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5G0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:01:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9TQE0"}, "ts": "2023-07-06 15:01:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9TQE0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:01:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NI08", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:01:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NI08.831.831"}, "ts": "2023-07-06 15:01:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06247RL"}, "ts": "2023-07-06 15:01:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21127"}, "ts": "2023-07-06 15:01:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G35655SC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 15:02:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G35655SC"}, "ts": "2023-07-06 15:02:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99683-1"}, "ts": "2023-07-06 15:02:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99683-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:02:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35555", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:02:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35555.306.306"}, "ts": "2023-07-06 15:02:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZRF8"}, "ts": "2023-07-06 15:02:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZRF8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 15:02:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80Z39"}, "ts": "2023-07-06 15:03:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80Z39", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 15:03:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NW68", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:03:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NW68"}, "ts": "2023-07-06 15:03:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25987BV"}, "ts": "2023-07-06 15:03:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01581", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:03:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q01581.261.261"}, "ts": "2023-07-06 15:03:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12837631", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:03:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12837631", "type": "PubMed"}, "ts": "2023-07-06 15:03:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15797", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:04:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15797"}, "ts": "2023-07-06 15:04:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35318"}, "ts": "2023-07-06 15:04:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35318", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:04:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12429842", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:04:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12429842", "type": "PubMed"}, "ts": "2023-07-06 15:04:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12840022", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:05:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12840022", "type": "PubMed"}, "ts": "2023-07-06 15:05:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30082", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:05:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4ZHG4"}, "ts": "2023-07-06 15:05:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4ZHG4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:05:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:05:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63261", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:05:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63261"}, "ts": "2023-07-06 15:05:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GPC1", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-06 15:05:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 15:05:38 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "GPC1"}, "ts": "2023-07-06 15:05:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 15:05:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GPC1", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=GPC1"}, "ts": "2023-07-06 15:05:38 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 15:05:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8b058b02c19c0db385e62838aaa7b69e", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 15:05:40 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "8b058b02c19c0db385e62838aaa7b69e", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 15:05:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94925", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:05:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94925"}, "ts": "2023-07-06 15:05:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99541", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:05:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99541"}, "ts": "2023-07-06 15:05:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35052-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:05:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35052-1"}, "ts": "2023-07-06 15:05:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66621EA"}, "ts": "2023-07-06 15:05:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91636VS"}, "ts": "2023-07-06 15:05:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-06 15:05:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-06 15:05:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 15:05:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q65Z93", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 15:06:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q65Z93"}, "ts": "2023-07-06 15:06:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84452RH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 15:06:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23708605", "type": "PubMed"}, "ts": "2023-07-06 15:06:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23708605", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:06:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51681.7.7"}, "ts": "2023-07-06 15:07:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51681", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:07:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G22310AV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 15:07:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62824GF"}, "ts": "2023-07-06 15:07:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07392QY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 15:07:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06907.233.233"}, "ts": "2023-07-06 15:07:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06907", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:07:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5SW79"}, "ts": "2023-07-06 15:07:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SW79", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 15:07:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P46976.332.332"}, "ts": "2023-07-06 15:07:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46976", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:07:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WY91"}, "ts": "2023-07-06 15:07:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WY91", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:07:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N8U9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:08:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A4ZYQ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:08:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N8U9.443.443"}, "ts": "2023-07-06 15:08:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A4ZYQ5"}, "ts": "2023-07-06 15:08:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GPC2", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-06 15:08:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 15:08:41 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "GPC2"}, "ts": "2023-07-06 15:08:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 15:08:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GPC2", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=GPC2"}, "ts": "2023-07-06 15:08:41 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 15:08:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8d2ece1bb17f74ac408bbbb08936e8b9", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 15:08:43 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "8d2ece1bb17f74ac408bbbb08936e8b9", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 15:08:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N158-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:08:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N158-1"}, "ts": "2023-07-06 15:08:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55089"}, "ts": "2023-07-06 15:09:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55089", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 15:09:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C5S7"}, "ts": "2023-07-06 15:09:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C5S7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:09:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5EBL8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:09:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5EBL8.124.124"}, "ts": "2023-07-06 15:09:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96EM0.341.341"}, "ts": "2023-07-06 15:09:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96EM0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:09:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00031MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 15:09:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00156-1"}, "ts": "2023-07-06 15:09:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19088451", "type": "PubMed"}, "ts": "2023-07-06 15:09:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19088451", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:09:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13439", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:10:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13439.834.834"}, "ts": "2023-07-06 15:10:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70232", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:10:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P70232.1181.1181"}, "ts": "2023-07-06 15:10:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q674X7"}, "ts": "2023-07-06 15:10:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q674X7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:10:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H3G5.346.346"}, "ts": "2023-07-06 15:10:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94901.48.48"}, "ts": "2023-07-06 15:10:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94901", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:10:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H944", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:11:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H944"}, "ts": "2023-07-06 15:11:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "36920409", "type": "PubMed"}, "ts": "2023-07-06 15:11:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "36920409", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:11:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15465"}, "ts": "2023-07-06 15:11:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P22002.1927.1927"}, "ts": "2023-07-06 15:11:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22002", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:11:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GPC3", "user": "Undecided", "type": "user", "page": "publication", "message": "Performing Global Search"}, "ts": "2023-07-06 15:11:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZU60-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:11:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 15:11:48 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "GPC3"}, "ts": "2023-07-06 15:11:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 15:11:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GPC3", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=GPC3"}, "ts": "2023-07-06 15:11:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZU60-1"}, "ts": "2023-07-06 15:11:48 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 15:11:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "82baec8b171ab6fb2469196e0e51e751", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 15:11:53 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "82baec8b171ab6fb2469196e0e51e751", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 15:11:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51654-1"}, "ts": "2023-07-06 15:11:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51654-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:12:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75352", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:12:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R1N9"}, "ts": "2023-07-06 15:13:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R1N9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:13:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15942"}, "ts": "2023-07-06 15:13:17 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q61666", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 15:13:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61666", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 15:13:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BUR4"}, "ts": "2023-07-06 15:13:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BUR4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:13:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11831"}, "ts": "2023-07-06 15:14:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A1L3C1"}, "ts": "2023-07-06 15:15:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11831", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:15:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A1L3C1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:15:02 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 15:15:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "82baec8b171ab6fb2469196e0e51e751", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 15:15:02 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "82baec8b171ab6fb2469196e0e51e751", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 15:15:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P36952.97.97"}, "ts": "2023-07-06 15:15:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36952", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:15:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GPC6", "user": "Undecided", "type": "user", "page": "protein-list", "message": "Performing Global Search"}, "ts": "2023-07-06 15:15:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 15:15:08 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "GPC6"}, "ts": "2023-07-06 15:15:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 15:15:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GPC6", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=GPC6"}, "ts": "2023-07-06 15:15:08 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 15:15:09 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "01b1ecb914c34da8045902b9e0c0f704", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 15:15:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "01b1ecb914c34da8045902b9e0c0f704", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 15:15:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y625-1"}, "ts": "2023-07-06 15:15:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y625-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:15:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P0K1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:15:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P0K1.634.634"}, "ts": "2023-07-06 15:15:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NC60-1"}, "ts": "2023-07-06 15:15:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NC60-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:15:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P82450"}, "ts": "2023-07-06 15:16:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02311IE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 15:16:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11323673", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:16:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11323673", "type": "PubMed"}, "ts": "2023-07-06 15:16:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UXG2"}, "ts": "2023-07-06 15:16:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXG2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:16:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00342"}, "ts": "2023-07-06 15:16:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "SDC1", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-06 15:17:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 15:17:03 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "SDC1"}, "ts": "2023-07-06 15:17:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 15:17:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "SDC1", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=SDC1"}, "ts": "2023-07-06 15:17:03 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 15:17:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9179684405e065c62350ddb75d0ef6ea", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 15:17:05 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "9179684405e065c62350ddb75d0ef6ea", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 15:17:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18827-1"}, "ts": "2023-07-06 15:17:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18827-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:17:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NWW9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:17:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NWW9"}, "ts": "2023-07-06 15:17:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53434XO"}, "ts": "2023-07-06 15:17:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58001LT"}, "ts": "2023-07-06 15:17:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57317CE"}, "ts": "2023-07-06 15:17:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73004SD"}, "ts": "2023-07-06 15:17:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-06 15:17:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54757", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 15:17:28 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P54757", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 15:17:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06247RL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 15:17:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UMF0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:17:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UMF0.214.214"}, "ts": "2023-07-06 15:17:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21127", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:17:47 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P00441", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 15:17:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00441", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 15:17:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11350175", "type": "PubMed"}, "ts": "2023-07-06 15:18:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11350175", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:18:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95466", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:18:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95466.1026.1026"}, "ts": "2023-07-06 15:18:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O88766.113.113"}, "ts": "2023-07-06 15:18:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88766", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:18:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z2W7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:19:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z2W7"}, "ts": "2023-07-06 15:19:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NER0"}, "ts": "2023-07-06 15:19:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NER0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 15:19:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16860"}, "ts": "2023-07-06 15:19:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y618", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:20:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y618"}, "ts": "2023-07-06 15:21:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G75097UM"}, "ts": "2023-07-06 15:21:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G75097UM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 15:21:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TI2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:21:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TI2"}, "ts": "2023-07-06 15:21:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86W33"}, "ts": "2023-07-06 15:21:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86W33", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:21:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8BRU6.56.56"}, "ts": "2023-07-06 15:21:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BRU6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:21:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17707", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:22:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17707.298.298"}, "ts": "2023-07-06 15:22:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4V8F5-1"}, "ts": "2023-07-06 15:22:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4V8F5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:22:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98088"}, "ts": "2023-07-06 15:23:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:23:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98088", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:23:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26493RP"}, "ts": "2023-07-06 15:23:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-06 15:23:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29931IJ"}, "ts": "2023-07-06 15:23:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31685JQ"}, "ts": "2023-07-06 15:23:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32550BI"}, "ts": "2023-07-06 15:23:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38887TM"}, "ts": "2023-07-06 15:23:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42665KV"}, "ts": "2023-07-06 15:23:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49582PC"}, "ts": "2023-07-06 15:23:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58272ZE"}, "ts": "2023-07-06 15:23:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63110FE"}, "ts": "2023-07-06 15:23:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63628AV"}, "ts": "2023-07-06 15:23:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64973KT"}, "ts": "2023-07-06 15:23:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74722FL"}, "ts": "2023-07-06 15:23:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76163CP"}, "ts": "2023-07-06 15:23:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78315FS"}, "ts": "2023-07-06 15:23:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81006GJ"}, "ts": "2023-07-06 15:23:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94435QH"}, "ts": "2023-07-06 15:23:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QZI7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:23:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QZI7"}, "ts": "2023-07-06 15:23:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27816-1"}, "ts": "2023-07-06 15:23:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14810", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 15:23:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "SDC2", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-06 15:23:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14810"}, "ts": "2023-07-06 15:23:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 15:23:55 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "SDC2"}, "ts": "2023-07-06 15:23:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 15:23:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "SDC2", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=SDC2"}, "ts": "2023-07-06 15:23:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQ88-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:23:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQ88-1"}, "ts": "2023-07-06 15:23:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NMS7"}, "ts": "2023-07-06 15:24:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NMS7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:24:02 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 15:24:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "81e4d0fdd3a6197ad981cf071a8d54ba", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 15:24:02 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "81e4d0fdd3a6197ad981cf071a8d54ba", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 15:24:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P34741-1"}, "ts": "2023-07-06 15:24:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34741-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:24:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29931IJ"}, "ts": "2023-07-06 15:24:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:24:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23246"}, "ts": "2023-07-06 15:24:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23246", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:24:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 15:24:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 15:24:43 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 15:24:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 15:24:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86750HK"}, "ts": "2023-07-06 15:24:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08146BT"}, "ts": "2023-07-06 15:24:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64132UH"}, "ts": "2023-07-06 15:24:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37626XQ"}, "ts": "2023-07-06 15:24:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81459MV"}, "ts": "2023-07-06 15:24:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93822DY"}, "ts": "2023-07-06 15:24:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08606CV"}, "ts": "2023-07-06 15:24:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24005JZ"}, "ts": "2023-07-06 15:24:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67393WG"}, "ts": "2023-07-06 15:24:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 15:24:47 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 15:24:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72956NR"}, "ts": "2023-07-06 15:24:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30048DT"}, "ts": "2023-07-06 15:24:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48844XN"}, "ts": "2023-07-06 15:24:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-06 15:24:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94019IV"}, "ts": "2023-07-06 15:24:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74026TS"}, "ts": "2023-07-06 15:24:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90889KG"}, "ts": "2023-07-06 15:24:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55818EE"}, "ts": "2023-07-06 15:24:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93720QH"}, "ts": "2023-07-06 15:24:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35242IF"}, "ts": "2023-07-06 15:24:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-06 15:24:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000034"}, "ts": "2023-07-06 15:24:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42039FI"}, "ts": "2023-07-06 15:24:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83385WA"}, "ts": "2023-07-06 15:24:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69616RY"}, "ts": "2023-07-06 15:24:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 15:24:49 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "G17689DH", "term_category": "any"}, "ts": "2023-07-06 15:24:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">6db0a535f896f31ad73eeecc521ee9e7", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"G17689DH\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 15:24:49 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6db0a535f896f31ad73eeecc521ee9e7", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 15:24:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6db0a535f896f31ad73eeecc521ee9e7", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 15:24:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29255IL"}, "ts": "2023-07-06 15:24:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61734US"}, "ts": "2023-07-06 15:24:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92180XB"}, "ts": "2023-07-06 15:24:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 15:24:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17689DH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 15:24:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000034"}, "ts": "2023-07-06 15:24:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83385WA"}, "ts": "2023-07-06 15:24:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69616RY"}, "ts": "2023-07-06 15:24:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16637646", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:24:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16637646", "type": "PubMed"}, "ts": "2023-07-06 15:24:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16754668", "type": "PubMed"}, "ts": "2023-07-06 15:25:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16754668", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:25:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8407880", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:25:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8407880", "type": "PubMed"}, "ts": "2023-07-06 15:25:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:25:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-06 15:25:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01543ZX"}, "ts": "2023-07-06 15:25:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-06 15:25:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45637XA"}, "ts": "2023-07-06 15:25:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-06 15:25:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-06 15:25:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52126RR"}, "ts": "2023-07-06 15:25:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57789QC"}, "ts": "2023-07-06 15:25:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60542VK"}, "ts": "2023-07-06 15:25:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64394MX"}, "ts": "2023-07-06 15:25:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74239ZQ"}, "ts": "2023-07-06 15:25:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77252PU"}, "ts": "2023-07-06 15:25:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89664KV"}, "ts": "2023-07-06 15:25:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93656SY"}, "ts": "2023-07-06 15:25:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H4A3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:25:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H4A3.716.716"}, "ts": "2023-07-06 15:25:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00156-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:25:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27577-1"}, "ts": "2023-07-06 15:25:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27577-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:25:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42893-1"}, "ts": "2023-07-06 15:25:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42893-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:25:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5EBA3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:26:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5EBA3-1"}, "ts": "2023-07-06 15:26:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 15:26:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G99003YY"}, "ts": "2023-07-06 15:26:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G99003YY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 15:26:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6L6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:26:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6L6.663.663"}, "ts": "2023-07-06 15:26:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15084261", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:26:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15084261", "type": "PubMed"}, "ts": "2023-07-06 15:26:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15465", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:27:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 15:27:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68FS4", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 15:27:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99LL3"}, "ts": "2023-07-06 15:27:30 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q68FS4", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 15:27:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99LL3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 15:27:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G75903TQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 15:27:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G75903TQ"}, "ts": "2023-07-06 15:27:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVS2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:28:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IVS2.92.92"}, "ts": "2023-07-06 15:28:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R1V6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:28:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R1V6"}, "ts": "2023-07-06 15:28:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:28:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A3U7-1"}, "ts": "2023-07-06 15:28:18 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q92905-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 15:28:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A3U7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:28:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92905-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 15:28:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19511"}, "ts": "2023-07-06 15:29:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19511", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:29:06 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 15:29:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 15:29:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 15:29:06 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-06 15:29:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-06 15:29:07 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 15:29:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15942", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:29:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 15:29:20 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 15:29:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68EM7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:29:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68EM7"}, "ts": "2023-07-06 15:29:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PY6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:29:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PY6"}, "ts": "2023-07-06 15:29:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30517YN"}, "ts": "2023-07-06 15:29:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43883"}, "ts": "2023-07-06 15:30:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TBE0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:30:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TBE0.686.686"}, "ts": "2023-07-06 15:30:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IYL3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:30:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IYL3"}, "ts": "2023-07-06 15:30:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97946-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:30:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97946-1"}, "ts": "2023-07-06 15:30:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:31:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "17311996"}, "ts": "2023-07-06 15:31:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 15:31:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99574.321.321"}, "ts": "2023-07-06 15:31:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99574", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:31:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15255MA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 15:31:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15255MA"}, "ts": "2023-07-06 15:32:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P82450", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:32:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P45973", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:32:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P45973"}, "ts": "2023-07-06 15:32:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00342", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:32:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:33:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06796", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:33:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06796.162.162"}, "ts": "2023-07-06 15:33:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TI4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:33:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86TI4.157.157"}, "ts": "2023-07-06 15:33:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 15:33:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UVK1"}, "ts": "2023-07-06 15:33:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UVK1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 15:33:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11388-1"}, "ts": "2023-07-06 15:34:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4H2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:34:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4H2"}, "ts": "2023-07-06 15:34:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4H2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:34:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4H2"}, "ts": "2023-07-06 15:34:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N1L4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:34:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N1L4"}, "ts": "2023-07-06 15:34:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:35:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20545310", "type": "PubMed"}, "ts": "2023-07-06 15:36:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20545310", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:36:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M8L9-1"}, "ts": "2023-07-06 15:37:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M8L9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:37:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:38:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YS7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:38:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86YS7.82.82"}, "ts": "2023-07-06 15:38:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G39689FZ"}, "ts": "2023-07-06 15:38:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G39689FZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 15:38:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G01187XC"}, "ts": "2023-07-06 15:38:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G01187XC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 15:38:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60826"}, "ts": "2023-07-06 15:38:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60826", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:38:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27816-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:39:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KMP7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:40:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KMP7-1"}, "ts": "2023-07-06 15:40:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:40:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08172"}, "ts": "2023-07-06 15:40:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08172", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:40:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60867", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 15:40:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60867"}, "ts": "2023-07-06 15:40:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31576058", "type": "PubMed"}, "ts": "2023-07-06 15:40:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31576058", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:40:33 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9BZ29", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 15:40:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZ29", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 15:40:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29605488", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:41:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29605488", "type": "PubMed"}, "ts": "2023-07-06 15:41:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22105", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:41:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:41:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22105"}, "ts": "2023-07-06 15:41:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P82970.31.31"}, "ts": "2023-07-06 15:41:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P82970", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:41:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9ULX7.215.215"}, "ts": "2023-07-06 15:42:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULX7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:42:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A853"}, "ts": "2023-07-06 15:42:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A853", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:42:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10253-1"}, "ts": "2023-07-06 15:42:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PI73"}, "ts": "2023-07-06 15:42:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PI73", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:42:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6IF63.133.133"}, "ts": "2023-07-06 15:42:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IF63", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:42:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 15:43:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G25833JG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 15:43:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G25833JG"}, "ts": "2023-07-06 15:43:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "sdc3", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-06 15:43:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 15:43:34 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "sdc3"}, "ts": "2023-07-06 15:43:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 15:43:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "sdc3", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=sdc3"}, "ts": "2023-07-06 15:43:34 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 15:43:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "d8b0dd0f6ec3a9b58baf1d1d9a1443eb", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 15:43:40 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "d8b0dd0f6ec3a9b58baf1d1d9a1443eb", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 15:43:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75056-1"}, "ts": "2023-07-06 15:43:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75056-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:43:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q69YZ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:43:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q69YZ2"}, "ts": "2023-07-06 15:43:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95785"}, "ts": "2023-07-06 15:43:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95785", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:43:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43156", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:44:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43156.746.746"}, "ts": "2023-07-06 15:44:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11279-1"}, "ts": "2023-07-06 15:44:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7918619", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:44:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7918619", "type": "PubMed"}, "ts": "2023-07-06 15:44:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9852145", "type": "PubMed"}, "ts": "2023-07-06 15:45:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9852145", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:45:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17948.914.914"}, "ts": "2023-07-06 15:45:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17948", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:45:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AY33"}, "ts": "2023-07-06 15:45:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AY33", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:45:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43883", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:45:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:46:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12424201", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:46:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12424201", "type": "PubMed"}, "ts": "2023-07-06 15:46:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14490.962.962"}, "ts": "2023-07-06 15:46:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14490", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:46:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VU97.587.587"}, "ts": "2023-07-06 15:46:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VU97", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:46:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22810696", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:47:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22810696", "type": "PubMed"}, "ts": "2023-07-06 15:47:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:47:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22810696", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_7) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/112.0.0.0 Safari/537.36"}, "ts": "2023-07-06 15:47:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G36123IU"}, "ts": "2023-07-06 15:47:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-06 15:47:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXC9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:47:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BXC9.463.463"}, "ts": "2023-07-06 15:47:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14195.499.499"}, "ts": "2023-07-06 15:47:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14195", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:47:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16176808", "type": "PubMed"}, "ts": "2023-07-06 15:48:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16176808", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:48:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9254848", "type": "PubMed"}, "ts": "2023-07-06 15:48:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9254848", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:48:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:48:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19338", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:48:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19338"}, "ts": "2023-07-06 15:48:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13310", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:48:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13310.306.306"}, "ts": "2023-07-06 15:48:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 15:48:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08182IE"}, "ts": "2023-07-06 15:49:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q17RC7"}, "ts": "2023-07-06 15:49:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:49:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q17RC7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:49:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "SDC4", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-06 15:50:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 15:50:05 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "SDC4"}, "ts": "2023-07-06 15:50:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 15:50:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "SDC4", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=SDC4"}, "ts": "2023-07-06 15:50:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CQX5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:50:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9CQX5.42.42"}, "ts": "2023-07-06 15:50:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11388-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:50:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-06 15:50:15 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 15:50:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0aae3332193b99ea05cb67c92a0f4b62", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 15:50:18 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "0aae3332193b99ea05cb67c92a0f4b62", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 15:50:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31431-1"}, "ts": "2023-07-06 15:50:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31431-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:50:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16401", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:50:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16401.106.106"}, "ts": "2023-07-06 15:50:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12665569", "type": "PubMed"}, "ts": "2023-07-06 15:50:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12665569", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:50:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5C9Z4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:50:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5C9Z4"}, "ts": "2023-07-06 15:50:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "19451274"}, "ts": "2023-07-06 15:51:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJP4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 15:51:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJP4"}, "ts": "2023-07-06 15:51:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JKK8-1"}, "ts": "2023-07-06 15:51:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JKK8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:51:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55081", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 15:51:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60215UL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 15:51:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25548159", "type": "PubMed"}, "ts": "2023-07-06 15:51:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55081"}, "ts": "2023-07-06 15:51:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25548159", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:51:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JU49", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:51:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G60215UL"}, "ts": "2023-07-06 15:51:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JU49"}, "ts": "2023-07-06 15:51:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CCS6-1"}, "ts": "2023-07-06 15:52:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CCS6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:52:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G78315FS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 15:52:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G78315FS"}, "ts": "2023-07-06 15:52:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UP52", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:52:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UP52.212.212"}, "ts": "2023-07-06 15:52:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18753675", "type": "PubMed"}, "ts": "2023-07-06 15:53:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18753675", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:53:10 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 15:53:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 15:53:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 15:53:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78371"}, "ts": "2023-07-06 15:53:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78371", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:53:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R1P5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 15:54:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14152"}, "ts": "2023-07-06 15:54:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14152", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:54:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R1P5"}, "ts": "2023-07-06 15:54:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q04900.146.146"}, "ts": "2023-07-06 15:54:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04900", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:54:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L5Y1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:54:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7L5Y1"}, "ts": "2023-07-06 15:54:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P49959-1.561.561"}, "ts": "2023-07-06 15:55:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49959-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:55:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TF40", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:55:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TF40"}, "ts": "2023-07-06 15:55:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03358-1"}, "ts": "2023-07-06 15:55:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03358-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:55:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00657", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 15:56:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q00657.2256.2256"}, "ts": "2023-07-06 15:56:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P57678"}, "ts": "2023-07-06 15:56:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07202", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:57:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07202"}, "ts": "2023-07-06 15:57:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9PTR6-1"}, "ts": "2023-07-06 15:57:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P2G9"}, "ts": "2023-07-06 15:57:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:57:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2G9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:57:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PTR6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:57:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBL0"}, "ts": "2023-07-06 15:57:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBL0"}, "ts": "2023-07-06 15:57:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBL0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:57:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBL0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:57:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 15:57:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G46677TE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 15:57:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G46677TE"}, "ts": "2023-07-06 15:57:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46677TE"}, "ts": "2023-07-06 15:57:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000107"}, "ts": "2023-07-06 15:57:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77976VJ"}, "ts": "2023-07-06 15:57:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94660EY"}, "ts": "2023-07-06 15:57:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37815LJ"}, "ts": "2023-07-06 15:57:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "tgfbr3", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-06 15:57:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 15:58:00 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "tgfbr3"}, "ts": "2023-07-06 15:58:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 15:58:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "tgfbr3", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=tgfbr3"}, "ts": "2023-07-06 15:58:01 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 15:58:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4f1622137973e306235d744d8a028365", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 15:58:13 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "4f1622137973e306235d744d8a028365", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 15:58:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03167-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:58:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03167-1"}, "ts": "2023-07-06 15:58:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10253-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:58:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26157024", "type": "PubMed"}, "ts": "2023-07-06 15:58:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26157024", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 15:58:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00548"}, "ts": "2023-07-06 15:59:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00548", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 15:59:36 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-06 16:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-06 16:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 16:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-06 16:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-06 16:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-06 16:00:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00300.307.307"}, "ts": "2023-07-06 16:00:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00300", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:00:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUN9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:01:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QUN9"}, "ts": "2023-07-06 16:01:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:01:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18316612", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:01:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18316612", "type": "PubMed"}, "ts": "2023-07-06 16:01:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYK6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:02:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYK6"}, "ts": "2023-07-06 16:02:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06247RL"}, "ts": "2023-07-06 16:02:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06247RL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 16:02:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10358004", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:02:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10358004", "type": "PubMed"}, "ts": "2023-07-06 16:02:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JUX4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:02:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JUX4"}, "ts": "2023-07-06 16:02:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15762.34.34"}, "ts": "2023-07-06 16:02:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q76LX8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:02:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15762", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:02:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q76LX8"}, "ts": "2023-07-06 16:02:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UUV7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:02:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UUV7.353.353"}, "ts": "2023-07-06 16:02:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBN7"}, "ts": "2023-07-06 16:03:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBN7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:03:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UBK2.539.539"}, "ts": "2023-07-06 16:03:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBK2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:03:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G36123IU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 16:03:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92552"}, "ts": "2023-07-06 16:03:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92552", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:03:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05724UK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 16:03:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "cd74", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-06 16:03:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 16:03:34 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "cd74"}, "ts": "2023-07-06 16:03:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 16:03:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "cd74", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=cd74"}, "ts": "2023-07-06 16:03:34 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 16:03:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "c330609ecd7a40e8bd83c736fd5cfdcd", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 16:03:37 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "c330609ecd7a40e8bd83c736fd5cfdcd", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 16:03:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04233-1"}, "ts": "2023-07-06 16:03:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04233-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:03:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-06 16:03:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83229XP"}, "ts": "2023-07-06 16:03:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25451PN"}, "ts": "2023-07-06 16:03:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71146HJ"}, "ts": "2023-07-06 16:03:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75983OB"}, "ts": "2023-07-06 16:03:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45495MK"}, "ts": "2023-07-06 16:03:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7513693", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:05:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7513693", "type": "PubMed"}, "ts": "2023-07-06 16:05:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54498TF"}, "ts": "2023-07-06 16:05:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46734", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:06:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46734"}, "ts": "2023-07-06 16:06:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BPP5"}, "ts": "2023-07-06 16:06:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BPP5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:06:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N4S7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:06:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N4S7"}, "ts": "2023-07-06 16:06:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7LBC6.647.647"}, "ts": "2023-07-06 16:06:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02751-15"}, "ts": "2023-07-06 16:06:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZR43"}, "ts": "2023-07-06 16:06:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZR43", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 16:07:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P03925-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:07:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P03925-1"}, "ts": "2023-07-06 16:07:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46783"}, "ts": "2023-07-06 16:07:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46783", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:07:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "CSPG4", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-06 16:07:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 16:07:58 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "CSPG4"}, "ts": "2023-07-06 16:07:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 16:07:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "CSPG4", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=CSPG4"}, "ts": "2023-07-06 16:07:59 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 16:08:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "a3aad0784c47ff1367ffb191a55d2aa2", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 16:08:00 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "a3aad0784c47ff1367ffb191a55d2aa2", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 16:08:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UVK1-1"}, "ts": "2023-07-06 16:08:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UVK1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:08:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JTN4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:08:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JTN4"}, "ts": "2023-07-06 16:08:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62765YT"}, "ts": "2023-07-06 16:08:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27391WQ"}, "ts": "2023-07-06 16:08:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39111QK"}, "ts": "2023-07-06 16:09:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYT3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:09:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYT3"}, "ts": "2023-07-06 16:09:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BWJ3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 16:09:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BWJ3"}, "ts": "2023-07-06 16:09:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JI67", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 16:09:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JI67"}, "ts": "2023-07-06 16:09:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G90335LR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 16:09:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19795417", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:09:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19795417", "type": "PubMed"}, "ts": "2023-07-06 16:09:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G90335LR"}, "ts": "2023-07-06 16:09:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8274023", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:10:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8274023", "type": "PubMed"}, "ts": "2023-07-06 16:10:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35555-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:10:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35555-1"}, "ts": "2023-07-06 16:10:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGU2"}, "ts": "2023-07-06 16:11:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGU2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:11:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z1S0"}, "ts": "2023-07-06 16:11:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1S0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 16:11:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42567"}, "ts": "2023-07-06 16:11:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42567", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 16:11:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08758-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:11:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08758-1"}, "ts": "2023-07-06 16:11:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19818708", "type": "PubMed"}, "ts": "2023-07-06 16:12:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19818708", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:12:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XID6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:12:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XID6-1"}, "ts": "2023-07-06 16:12:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57678", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:12:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G37158XG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 16:13:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NZI2"}, "ts": "2023-07-06 16:13:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NZI2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:13:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G37158XG"}, "ts": "2023-07-06 16:13:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16594", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:13:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08670", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:13:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16594"}, "ts": "2023-07-06 16:13:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08670.5.5"}, "ts": "2023-07-06 16:13:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6H8Q1"}, "ts": "2023-07-06 16:13:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:13:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6H8Q1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:13:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 16:13:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14583623", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:13:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14583623", "type": "PubMed"}, "ts": "2023-07-06 16:13:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9165038", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:13:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9165038", "type": "PubMed"}, "ts": "2023-07-06 16:13:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91YQ5"}, "ts": "2023-07-06 16:13:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91YQ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:13:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "8932977"}, "ts": "2023-07-06 16:13:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BWB1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:13:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BWB1-1"}, "ts": "2023-07-06 16:13:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G25520XG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 16:14:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ERE3-1"}, "ts": "2023-07-06 16:14:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:14:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17030"}, "ts": "2023-07-06 16:14:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ERE3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:14:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17030", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:14:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08842"}, "ts": "2023-07-06 16:14:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08842", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:14:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15105"}, "ts": "2023-07-06 16:14:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15105", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 16:14:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:14:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y661", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:14:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y661"}, "ts": "2023-07-06 16:14:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C7M3"}, "ts": "2023-07-06 16:15:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C7M3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:15:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68CJ9"}, "ts": "2023-07-06 16:15:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68CJ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:15:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25592972", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:15:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25592972", "type": "PubMed"}, "ts": "2023-07-06 16:15:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z266", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:15:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z266"}, "ts": "2023-07-06 16:15:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K083"}, "ts": "2023-07-06 16:16:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21498505", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:16:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21498505", "type": "PubMed"}, "ts": "2023-07-06 16:16:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1V8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:16:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H1V8"}, "ts": "2023-07-06 16:16:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K083", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 16:16:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14980", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:16:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14980"}, "ts": "2023-07-06 16:16:13 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "D3YU55-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 16:16:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3YU55-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 16:16:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3YU55-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-06 16:16:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00900"}, "ts": "2023-07-06 16:17:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00900", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:17:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6IYF9"}, "ts": "2023-07-06 16:17:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IYF9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:17:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXI7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:17:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9367685", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:17:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9367685", "type": "PubMed"}, "ts": "2023-07-06 16:17:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXI7"}, "ts": "2023-07-06 16:17:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UMY1"}, "ts": "2023-07-06 16:17:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UMY1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:17:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11091361", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:18:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11091361", "type": "PubMed"}, "ts": "2023-07-06 16:18:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZUW2"}, "ts": "2023-07-06 16:18:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZUW2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:18:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:18:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BUT9"}, "ts": "2023-07-06 16:18:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BUT9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:18:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "CD44", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-06 16:18:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 16:18:36 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "CD44"}, "ts": "2023-07-06 16:18:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 16:18:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "CD44", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=CD44"}, "ts": "2023-07-06 16:18:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00308"}, "ts": "2023-07-06 16:18:37 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 16:18:40 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "cc33cda7195016d6a16435d522e1cd9a", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 16:18:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "cc33cda7195016d6a16435d522e1cd9a", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 16:18:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16070-1"}, "ts": "2023-07-06 16:18:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16070-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:18:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6T3U3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:18:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6T3U3.506.506"}, "ts": "2023-07-06 16:18:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06330RB"}, "ts": "2023-07-06 16:18:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02030ZB"}, "ts": "2023-07-06 16:18:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-06 16:18:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13694XX"}, "ts": "2023-07-06 16:18:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15169WU"}, "ts": "2023-07-06 16:18:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20312EM"}, "ts": "2023-07-06 16:18:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23010ZW"}, "ts": "2023-07-06 16:18:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25418HZ"}, "ts": "2023-07-06 16:18:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33791AF"}, "ts": "2023-07-06 16:18:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37881RL"}, "ts": "2023-07-06 16:18:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39595FH"}, "ts": "2023-07-06 16:18:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44215PV"}, "ts": "2023-07-06 16:18:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46524LG"}, "ts": "2023-07-06 16:18:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47012YE"}, "ts": "2023-07-06 16:18:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47518TP"}, "ts": "2023-07-06 16:18:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CQX6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:19:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q58A45"}, "ts": "2023-07-06 16:19:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q58A45", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:19:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CQX6"}, "ts": "2023-07-06 16:19:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61592"}, "ts": "2023-07-06 16:20:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61592", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:20:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9GZK3.5.5"}, "ts": "2023-07-06 16:20:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZK3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:20:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62413"}, "ts": "2023-07-06 16:21:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62413", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 16:21:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZLU1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:21:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZLU1"}, "ts": "2023-07-06 16:21:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12939402", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:22:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12939402", "type": "PubMed"}, "ts": "2023-07-06 16:22:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58283-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:22:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P58283-1"}, "ts": "2023-07-06 16:22:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00053MO"}, "ts": "2023-07-06 16:22:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02751-15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:22:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18172500", "type": "PubMed"}, "ts": "2023-07-06 16:23:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18172500", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:23:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1956407", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:23:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1956407", "type": "PubMed"}, "ts": "2023-07-06 16:23:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31400829", "type": "PubMed"}, "ts": "2023-07-06 16:23:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31400829", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:23:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88952", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 16:23:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88952"}, "ts": "2023-07-06 16:23:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33360543", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:23:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33360543", "type": "PubMed"}, "ts": "2023-07-06 16:23:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09601", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:24:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09601.229.229"}, "ts": "2023-07-06 16:24:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36537", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:24:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36537"}, "ts": "2023-07-06 16:24:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D1N2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:24:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D1N2"}, "ts": "2023-07-06 16:24:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q70YC5"}, "ts": "2023-07-06 16:25:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q70YC5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:25:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P67936"}, "ts": "2023-07-06 16:25:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P67936", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:25:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24282534", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:25:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24282534", "type": "PubMed"}, "ts": "2023-07-06 16:25:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 16:25:42 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P08603", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 16:25:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08603", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 16:25:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43493.118.118"}, "ts": "2023-07-06 16:26:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43493", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:26:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96JB6"}, "ts": "2023-07-06 16:26:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JB6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:26:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 16:26:38 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 16:26:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 16:26:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47897", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:27:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47897"}, "ts": "2023-07-06 16:27:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TED9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:27:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TED9.696.696"}, "ts": "2023-07-06 16:27:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 16:27:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11177", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 16:27:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11177"}, "ts": "2023-07-06 16:27:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17224476", "type": "PubMed"}, "ts": "2023-07-06 16:28:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17224476", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:28:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95785", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:28:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14410", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:28:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95785"}, "ts": "2023-07-06 16:28:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14410"}, "ts": "2023-07-06 16:28:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:29:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0CJ79"}, "ts": "2023-07-06 16:29:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0CJ79", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:29:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZTQ4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:29:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZTQ4"}, "ts": "2023-07-06 16:29:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07483YN"}, "ts": "2023-07-06 16:29:08 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G69411IG"}, "ts": "2023-07-06 16:29:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32954656", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:29:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32954656", "type": "PubMed"}, "ts": "2023-07-06 16:29:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75369"}, "ts": "2023-07-06 16:30:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q640N1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 16:30:30 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q640N1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 16:30:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G38028NH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 16:30:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G38028NH"}, "ts": "2023-07-06 16:30:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 16:30:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41597"}, "ts": "2023-07-06 16:31:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41597", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:31:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26498689", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:31:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26498689", "type": "PubMed"}, "ts": "2023-07-06 16:31:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21217", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:31:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21217"}, "ts": "2023-07-06 16:31:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10380931", "type": "PubMed"}, "ts": "2023-07-06 16:31:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03358-1"}, "ts": "2023-07-06 16:31:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03358-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:31:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10380931", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:31:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q05CL8.335.335"}, "ts": "2023-07-06 16:31:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05CL8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:31:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95497-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:32:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95497-1"}, "ts": "2023-07-06 16:32:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y485.398.398"}, "ts": "2023-07-06 16:32:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y485", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:32:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02655"}, "ts": "2023-07-06 16:32:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02679"}, "ts": "2023-07-06 16:32:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36537", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:33:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P36537.314.314"}, "ts": "2023-07-06 16:33:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H4D0.716.716"}, "ts": "2023-07-06 16:34:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H4D0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:34:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12480931", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:34:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12480931", "type": "PubMed"}, "ts": "2023-07-06 16:34:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00308", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:34:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 16:35:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G47548GA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 16:35:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G47548GA"}, "ts": "2023-07-06 16:35:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WVL6"}, "ts": "2023-07-06 16:35:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WVL6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:35:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:35:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47548GA"}, "ts": "2023-07-06 16:35:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89864HJ"}, "ts": "2023-07-06 16:35:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49295JM"}, "ts": "2023-07-06 16:35:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09551MC"}, "ts": "2023-07-06 16:35:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000015"}, "ts": "2023-07-06 16:35:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H1C0"}, "ts": "2023-07-06 16:35:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1C0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:35:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G51519NL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 16:35:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G51519NL"}, "ts": "2023-07-06 16:35:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7LBC6"}, "ts": "2023-07-06 16:36:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7LBC6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:36:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38432", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:36:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P38432"}, "ts": "2023-07-06 16:36:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N9B5"}, "ts": "2023-07-06 16:36:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N9B5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:36:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N4A0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:37:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N4A0"}, "ts": "2023-07-06 16:37:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13469"}, "ts": "2023-07-06 16:37:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13469", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:37:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10383923", "type": "PubMed"}, "ts": "2023-07-06 16:37:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10383923", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:37:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:37:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6W2J9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:37:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6W2J9"}, "ts": "2023-07-06 16:37:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02030ZB"}, "ts": "2023-07-06 16:38:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00053MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 16:38:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUN5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:38:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NUN5"}, "ts": "2023-07-06 16:38:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33945466", "type": "PubMed"}, "ts": "2023-07-06 16:39:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33945466", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:39:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08945", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:39:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08945"}, "ts": "2023-07-06 16:39:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8CBR1.490.490"}, "ts": "2023-07-06 16:39:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CBR1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:39:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:39:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2A7"}, "ts": "2023-07-06 16:39:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2A7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:39:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:39:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Ptprz1", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-06 16:40:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 16:40:02 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Ptprz1"}, "ts": "2023-07-06 16:40:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 16:40:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Ptprz1", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Ptprz1"}, "ts": "2023-07-06 16:40:03 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 16:40:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ca938bf0fd68bac3a2ade24f9a1612bc", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 16:40:04 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "ca938bf0fd68bac3a2ade24f9a1612bc", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 16:40:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23471-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:40:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23471-1"}, "ts": "2023-07-06 16:40:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02094", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:40:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02094"}, "ts": "2023-07-06 16:40:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14994KB"}, "ts": "2023-07-06 16:40:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54992WG"}, "ts": "2023-07-06 16:40:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54600FO"}, "ts": "2023-07-06 16:40:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83676GD"}, "ts": "2023-07-06 16:40:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HBH1.109.109"}, "ts": "2023-07-06 16:40:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBH1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:40:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92956", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:41:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92956"}, "ts": "2023-07-06 16:41:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDW0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:41:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TDW0.91.91"}, "ts": "2023-07-06 16:41:19 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P43006", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 16:41:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43006", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 16:41:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:42:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y613", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:42:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y613"}, "ts": "2023-07-06 16:42:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16606666", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:42:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16606666", "type": "PubMed"}, "ts": "2023-07-06 16:42:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:42:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99P99-1"}, "ts": "2023-07-06 16:42:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99P99-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:42:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60508", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:42:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60508"}, "ts": "2023-07-06 16:42:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKS6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:42:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKS6"}, "ts": "2023-07-06 16:43:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06756"}, "ts": "2023-07-06 16:43:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32519"}, "ts": "2023-07-06 16:43:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32519", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:43:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6XZB0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:44:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6XZB0"}, "ts": "2023-07-06 16:44:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDG2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 16:44:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDG2"}, "ts": "2023-07-06 16:44:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07483YN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 16:44:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CQC6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 16:45:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CQC6"}, "ts": "2023-07-06 16:45:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G69411IG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 16:45:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14523"}, "ts": "2023-07-06 16:45:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14523", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:45:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IY22-1"}, "ts": "2023-07-06 16:45:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IY22-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:45:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08116", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:46:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08116"}, "ts": "2023-07-06 16:46:06 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q3T1H2", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 16:46:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3T1H2", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 16:46:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 16:46:09 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q920L2-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 16:46:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q920L2-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 16:46:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3T1H2", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (compatible; YandexBot/3.0;  http://yandex.com/bots) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/108.0.0.0"}, "ts": "2023-07-06 16:46:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75369", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:46:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:46:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P30835.377.377"}, "ts": "2023-07-06 16:46:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30835", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:46:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91YQ5"}, "ts": "2023-07-06 16:46:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91YQ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:46:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30835", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:47:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P30835.775.775"}, "ts": "2023-07-06 16:47:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z3D4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:47:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z3D4.4.4"}, "ts": "2023-07-06 16:47:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07759-1"}, "ts": "2023-07-06 16:47:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61759"}, "ts": "2023-07-06 16:47:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61759", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 16:47:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22673903", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:47:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22673903", "type": "PubMed"}, "ts": "2023-07-06 16:47:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:47:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02080VH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 16:47:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02080VH"}, "ts": "2023-07-06 16:47:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L91", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:48:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96L91"}, "ts": "2023-07-06 16:48:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02655", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:48:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13029.16.16"}, "ts": "2023-07-06 16:48:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13029", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:48:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZE3"}, "ts": "2023-07-06 16:48:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZE3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:48:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q401N2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:48:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q401N2"}, "ts": "2023-07-06 16:48:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02679", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:48:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:48:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17677", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:48:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17677"}, "ts": "2023-07-06 16:48:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BD0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:49:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96BD0"}, "ts": "2023-07-06 16:49:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LR02"}, "ts": "2023-07-06 16:49:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LR02", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 16:49:22 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8IWU5", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 16:50:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWU5", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 16:50:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z739", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:50:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z739.139.139"}, "ts": "2023-07-06 16:50:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NG11", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:50:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NG11"}, "ts": "2023-07-06 16:50:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N573", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:51:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N573"}, "ts": "2023-07-06 16:51:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07141"}, "ts": "2023-07-06 16:51:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BPP5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:51:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BPP5"}, "ts": "2023-07-06 16:51:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61093"}, "ts": "2023-07-06 16:51:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61093", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:51:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BRA2"}, "ts": "2023-07-06 16:51:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BRA2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:51:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00592", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:51:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00592.232.232"}, "ts": "2023-07-06 16:51:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34478713", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:51:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34478713", "type": "PubMed"}, "ts": "2023-07-06 16:51:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "THBD", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-06 16:52:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 16:52:14 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "THBD"}, "ts": "2023-07-06 16:52:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 16:52:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "THBD", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=THBD"}, "ts": "2023-07-06 16:52:14 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 16:52:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ba3628b659daf32823ce53ffc39465dc", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 16:52:16 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "ba3628b659daf32823ce53ffc39465dc", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 16:52:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07204-1"}, "ts": "2023-07-06 16:52:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07204-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:52:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77199IL"}, "ts": "2023-07-06 16:52:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84168AG"}, "ts": "2023-07-06 16:52:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04275"}, "ts": "2023-07-06 16:52:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VDX6"}, "ts": "2023-07-06 16:52:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VDX6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 16:52:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0D2K2"}, "ts": "2023-07-06 16:52:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0D2K2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 16:52:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UNN8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:53:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:53:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UNN8"}, "ts": "2023-07-06 16:53:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35964-1"}, "ts": "2023-07-06 16:53:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35964-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:53:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22059"}, "ts": "2023-07-06 16:53:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55412XP"}, "ts": "2023-07-06 16:53:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G94827SR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 16:53:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75983OB"}, "ts": "2023-07-06 16:53:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G94827SR"}, "ts": "2023-07-06 16:53:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56784JY"}, "ts": "2023-07-06 16:53:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02030ZB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 16:54:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4ABX6-1"}, "ts": "2023-07-06 16:54:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4ABX6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:54:26 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9UIU6", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 16:54:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UIU6", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 16:55:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28300"}, "ts": "2023-07-06 16:55:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17612-1.202.202"}, "ts": "2023-07-06 16:55:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17612-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:55:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BVW5", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 16:55:58 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9BVW5", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 16:55:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:56:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05166", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:56:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05166"}, "ts": "2023-07-06 16:56:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2Y0W8"}, "ts": "2023-07-06 16:56:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2Y0W8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:56:24 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q96JG6", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 16:56:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JG6", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 16:56:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61967-1"}, "ts": "2023-07-06 16:56:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61967-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:56:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R4W1"}, "ts": "2023-07-06 16:57:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R4W1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 16:57:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PY6"}, "ts": "2023-07-06 16:57:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PY6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:57:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13526", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:57:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13526"}, "ts": "2023-07-06 16:57:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14980"}, "ts": "2023-07-06 16:58:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14980", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:58:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CXR4"}, "ts": "2023-07-06 16:58:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CXR4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:58:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8C850.115.115"}, "ts": "2023-07-06 16:58:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C850", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:58:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G51519NL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 16:58:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G51519NL"}, "ts": "2023-07-06 16:58:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20080650", "type": "PubMed"}, "ts": "2023-07-06 16:58:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20080650", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 16:58:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AXU5"}, "ts": "2023-07-06 16:58:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AXU5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:58:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13561"}, "ts": "2023-07-06 16:58:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13561", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:58:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:58:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A577", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:58:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A577"}, "ts": "2023-07-06 16:58:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54132"}, "ts": "2023-07-06 16:58:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54132", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:58:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:59:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UGM3.806.806"}, "ts": "2023-07-06 16:59:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGM3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:59:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06756", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 16:59:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75113", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 16:59:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75113.416.416"}, "ts": "2023-07-06 16:59:37 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-06 17:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-06 17:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 17:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-06 17:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-06 17:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-06 17:00:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZWL1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:00:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZWL1-1"}, "ts": "2023-07-06 17:00:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63799"}, "ts": "2023-07-06 17:01:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63799", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 17:01:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T750"}, "ts": "2023-07-06 17:01:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T750", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 17:01:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-06 17:02:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96T83.609.609"}, "ts": "2023-07-06 17:02:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96T83", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:02:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21347838", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 17:02:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21347838", "type": "PubMed"}, "ts": "2023-07-06 17:02:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21347838", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 17:02:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 17:02:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N697.114.114"}, "ts": "2023-07-06 17:02:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N697", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:02:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UBG2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:03:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q3UBG2.202.202"}, "ts": "2023-07-06 17:03:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53351-1"}, "ts": "2023-07-06 17:03:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53351-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:03:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18587492", "type": "PubMed"}, "ts": "2023-07-06 17:03:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18587492", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 17:03:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07759-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:03:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16143108", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 17:04:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16143108", "type": "PubMed"}, "ts": "2023-07-06 17:04:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29738435", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 17:04:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29738435", "type": "PubMed"}, "ts": "2023-07-06 17:04:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RYD7-1"}, "ts": "2023-07-06 17:05:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RYD7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:05:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IYB7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:05:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IYB7"}, "ts": "2023-07-06 17:05:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5T481.41.41"}, "ts": "2023-07-06 17:05:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T481", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:05:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5QNW6.37.37"}, "ts": "2023-07-06 17:05:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5QNW6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:06:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IXF0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 17:06:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IXF0"}, "ts": "2023-07-06 17:06:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24549-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:07:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24549-1"}, "ts": "2023-07-06 17:07:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07141", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:07:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43003"}, "ts": "2023-07-06 17:07:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43003", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:07:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G01342FO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:07:36 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G01342FO"}, "ts": "2023-07-06 17:07:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55265.281.281"}, "ts": "2023-07-06 17:08:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55265", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:08:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04275", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:08:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01860"}, "ts": "2023-07-06 17:08:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4AB98", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:08:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "D4AB98.87.87"}, "ts": "2023-07-06 17:08:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "pyruvate kinase", "user": "Undecided", "type": "user", "page": "Siteview", "message": "Performing Global Search"}, "ts": "2023-07-06 17:09:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 17:09:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 17:09:11 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "pyruvate kinase"}, "ts": "2023-07-06 17:09:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZCL4-1"}, "ts": "2023-07-06 17:09:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZCL4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:09:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "pyruvate kinase", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=pyruvate kinase"}, "ts": "2023-07-06 17:09:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86T26", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:09:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86T26"}, "ts": "2023-07-06 17:09:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16445568", "type": "PubMed"}, "ts": "2023-07-06 17:09:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16445568", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 17:09:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22059", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:09:21 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 17:09:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "319e103605461e9f4345a6df2d1bc06f", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 17:09:23 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "319e103605461e9f4345a6df2d1bc06f", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 17:09:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A8I6A7K2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:09:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A8I6A7K2-1"}, "ts": "2023-07-06 17:09:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C5Y9"}, "ts": "2023-07-06 17:09:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C5Y9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:09:52 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-06 17:10:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "319e103605461e9f4345a6df2d1bc06f", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-06 17:10:07 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "319e103605461e9f4345a6df2d1bc06f", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-06 17:10:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 17:10:08 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "pyruvate kinase"}, "ts": "2023-07-06 17:10:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "pyruvate kinase", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=pyruvate kinase"}, "ts": "2023-07-06 17:10:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60230HH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:10:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96881BQ"}, "ts": "2023-07-06 17:10:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G21290RB"}, "ts": "2023-07-06 17:10:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q17R60"}, "ts": "2023-07-06 17:10:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q17R60", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:10:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15121"}, "ts": "2023-07-06 17:10:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G82529OA"}, "ts": "2023-07-06 17:11:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G82529OA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:11:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDR0-1"}, "ts": "2023-07-06 17:11:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDR0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:11:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28300", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:11:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UP44", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:11:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UP44"}, "ts": "2023-07-06 17:11:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZVY9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:11:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZVY9-1"}, "ts": "2023-07-06 17:11:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17661.105.105"}, "ts": "2023-07-06 17:12:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17661", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:12:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P0M2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:12:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P0M2"}, "ts": "2023-07-06 17:12:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00749"}, "ts": "2023-07-06 17:12:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K1B6-1"}, "ts": "2023-07-06 17:12:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K1B6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:12:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16549", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:12:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16549.469.469"}, "ts": "2023-07-06 17:12:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97432-1"}, "ts": "2023-07-06 17:12:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G32460TA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:12:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G32460TA"}, "ts": "2023-07-06 17:12:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97432-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:12:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P52926.14.14"}, "ts": "2023-07-06 17:12:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52926", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:12:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00109SL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:12:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00109SL"}, "ts": "2023-07-06 17:12:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UK28-1"}, "ts": "2023-07-06 17:12:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UK28-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:13:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28605553", "type": "PubMed"}, "ts": "2023-07-06 17:13:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28605553", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 17:13:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20264", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:13:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P20264.88.88"}, "ts": "2023-07-06 17:13:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q93008"}, "ts": "2023-07-06 17:14:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z5M5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:14:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JHJ3"}, "ts": "2023-07-06 17:14:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z5M5"}, "ts": "2023-07-06 17:14:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JHJ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:14:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHI8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:14:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHI8"}, "ts": "2023-07-06 17:14:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14011", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:15:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14011"}, "ts": "2023-07-06 17:15:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52594"}, "ts": "2023-07-06 17:16:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52594", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:16:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CA72", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:16:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CA72"}, "ts": "2023-07-06 17:16:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5M775.55.55"}, "ts": "2023-07-06 17:16:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5M775", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:16:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M324", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:16:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M324"}, "ts": "2023-07-06 17:16:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14126"}, "ts": "2023-07-06 17:17:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14126", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:17:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H461", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:17:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H461.247.247"}, "ts": "2023-07-06 17:17:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54707"}, "ts": "2023-07-06 17:17:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32769119", "type": "PubMed"}, "ts": "2023-07-06 17:17:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32769119", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 17:17:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G26250DB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:18:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G26250DB"}, "ts": "2023-07-06 17:18:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G75088YO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:18:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G75088YO"}, "ts": "2023-07-06 17:18:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:18:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZM1"}, "ts": "2023-07-06 17:18:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66H09-1"}, "ts": "2023-07-06 17:18:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66H09-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:18:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P45379"}, "ts": "2023-07-06 17:19:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10426994", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 17:19:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLC4"}, "ts": "2023-07-06 17:19:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00959", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:19:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00959"}, "ts": "2023-07-06 17:19:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10426994", "type": "PubMed"}, "ts": "2023-07-06 17:19:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10052459", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 17:20:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10052459", "type": "PubMed"}, "ts": "2023-07-06 17:20:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R4T1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 17:20:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R4T1"}, "ts": "2023-07-06 17:20:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6V0.458.458"}, "ts": "2023-07-06 17:20:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6V0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:20:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NCF5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:20:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NCF5"}, "ts": "2023-07-06 17:20:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWA0"}, "ts": "2023-07-06 17:21:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWA0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:21:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IV42"}, "ts": "2023-07-06 17:21:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IV42", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:21:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G68969GZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:21:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G68969GZ"}, "ts": "2023-07-06 17:21:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:21:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A4UGR9.903.903"}, "ts": "2023-07-06 17:21:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A4UGR9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:21:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A4M0-1"}, "ts": "2023-07-06 17:22:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A4M0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:22:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09622", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:22:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09622"}, "ts": "2023-07-06 17:22:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43493.191.191"}, "ts": "2023-07-06 17:22:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VZE5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:22:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VZE5"}, "ts": "2023-07-06 17:22:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 17:22:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCD5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 17:22:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HCD5"}, "ts": "2023-07-06 17:22:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55260-1"}, "ts": "2023-07-06 17:23:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55260-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:23:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DD03", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:23:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DD03"}, "ts": "2023-07-06 17:23:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16762", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:23:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16762"}, "ts": "2023-07-06 17:23:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35527", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:23:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35527"}, "ts": "2023-07-06 17:23:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62005"}, "ts": "2023-07-06 17:23:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62005", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:23:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83952ID"}, "ts": "2023-07-06 17:24:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:24:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86WA8.253.253"}, "ts": "2023-07-06 17:24:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86WA8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:24:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZEP3-1"}, "ts": "2023-07-06 17:24:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZEP3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:24:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00558"}, "ts": "2023-07-06 17:25:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00558", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:25:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZHW1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:25:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZHW1-1"}, "ts": "2023-07-06 17:25:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09619", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:25:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09619.716.716"}, "ts": "2023-07-06 17:25:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13619"}, "ts": "2023-07-06 17:26:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13619", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:26:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96881BQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:26:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N0S6"}, "ts": "2023-07-06 17:26:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N0S6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:26:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G21290RB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:26:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BY32", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:26:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BY32"}, "ts": "2023-07-06 17:26:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15052.592.592"}, "ts": "2023-07-06 17:26:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15052", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:26:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84467IZ"}, "ts": "2023-07-06 17:26:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C3R1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 17:26:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C3R1"}, "ts": "2023-07-06 17:26:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6X6-1"}, "ts": "2023-07-06 17:26:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6X6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:26:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15121", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:26:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LYD3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:28:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LYD3-1"}, "ts": "2023-07-06 17:28:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SYB0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:28:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00749", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:28:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5SYB0"}, "ts": "2023-07-06 17:28:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BLR2-1"}, "ts": "2023-07-06 17:28:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BLR2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:28:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:29:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16659-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:29:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16659-1"}, "ts": "2023-07-06 17:29:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08887"}, "ts": "2023-07-06 17:29:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2QC38-1"}, "ts": "2023-07-06 17:29:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2QC38-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:29:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60215UL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:30:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G60215UL"}, "ts": "2023-07-06 17:30:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18307ZZ"}, "ts": "2023-07-06 17:30:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18307ZZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:30:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58375IA"}, "ts": "2023-07-06 17:30:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G58375IA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:30:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q93008", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:30:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15797", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:31:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15797.10.10"}, "ts": "2023-07-06 17:31:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q925F2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:31:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q925F2"}, "ts": "2023-07-06 17:31:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UWM9.353.353"}, "ts": "2023-07-06 17:31:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWM9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:31:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68FE2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:31:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q68FE2.738.738"}, "ts": "2023-07-06 17:31:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12165561", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 17:31:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12165561", "type": "PubMed"}, "ts": "2023-07-06 17:31:55 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 57}, "ts": "2023-07-06 17:32:05 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 7}, "ts": "2023-07-06 17:32:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G90000GD"}, "ts": "2023-07-06 17:32:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G90000GD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:32:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62786", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:32:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62786"}, "ts": "2023-07-06 17:32:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54707", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:33:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06213.43.43"}, "ts": "2023-07-06 17:33:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06213", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:33:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JKT3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:33:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G48027TR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:33:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G48027TR"}, "ts": "2023-07-06 17:33:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:33:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11362", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:33:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11362"}, "ts": "2023-07-06 17:33:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01857"}, "ts": "2023-07-06 17:33:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "g29068fm"}, "ts": "2023-07-06 17:33:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43424.508.508"}, "ts": "2023-07-06 17:33:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43424", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:33:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25063"}, "ts": "2023-07-06 17:33:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56845GO"}, "ts": "2023-07-06 17:34:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56845GO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:34:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68CJ9"}, "ts": "2023-07-06 17:35:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68CJ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:35:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHR5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:35:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHR5"}, "ts": "2023-07-06 17:35:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHR5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:35:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHR5"}, "ts": "2023-07-06 17:35:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P45379", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:35:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5TB80.1209.1209"}, "ts": "2023-07-06 17:35:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TB80", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:35:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:35:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00049MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:35:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00049MO"}, "ts": "2023-07-06 17:35:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91ZW3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:35:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q91ZW3.754.754"}, "ts": "2023-07-06 17:35:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NQW6.194.194"}, "ts": "2023-07-06 17:36:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQW6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:36:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13131"}, "ts": "2023-07-06 17:36:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49225WK"}, "ts": "2023-07-06 17:36:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22455"}, "ts": "2023-07-06 17:36:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33896830", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 17:36:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33896830", "type": "PubMed"}, "ts": "2023-07-06 17:36:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16422", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:36:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16422"}, "ts": "2023-07-06 17:36:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G16407EV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:36:58 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G16407EV"}, "ts": "2023-07-06 17:36:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86VP3"}, "ts": "2023-07-06 17:37:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86VP3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:37:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06961IX"}, "ts": "2023-07-06 17:37:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06961IX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:37:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98082"}, "ts": "2023-07-06 17:37:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZF92", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:38:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZF92"}, "ts": "2023-07-06 17:39:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WUG5"}, "ts": "2023-07-06 17:40:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WUG5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:40:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:40:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IUX7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:40:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G85590UT"}, "ts": "2023-07-06 17:40:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G85590UT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:40:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IUX7.404.404"}, "ts": "2023-07-06 17:40:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21777200", "type": "PubMed"}, "ts": "2023-07-06 17:40:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21777200", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 17:40:21 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 7}, "ts": "2023-07-06 17:40:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5DTL9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:40:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WV91"}, "ts": "2023-07-06 17:40:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WV91", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:40:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5DTL9"}, "ts": "2023-07-06 17:40:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88513", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:40:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88513"}, "ts": "2023-07-06 17:40:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P30542.151.151"}, "ts": "2023-07-06 17:41:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30542", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:41:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2A5X6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:41:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2A5X6"}, "ts": "2023-07-06 17:41:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9JLC8.2518.2518"}, "ts": "2023-07-06 17:41:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLC8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:41:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8845018", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 17:41:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8845018", "type": "PubMed"}, "ts": "2023-07-06 17:41:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NB14"}, "ts": "2023-07-06 17:41:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NB14", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:42:00 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 7}, "ts": "2023-07-06 17:42:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84467IZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:42:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15884"}, "ts": "2023-07-06 17:43:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15884", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:43:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13136"}, "ts": "2023-07-06 17:43:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13136", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:43:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84852GW"}, "ts": "2023-07-06 17:43:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 17:43:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UDV7"}, "ts": "2023-07-06 17:43:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UDV7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 17:43:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJY5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:44:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJY5"}, "ts": "2023-07-06 17:44:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35052"}, "ts": "2023-07-06 17:44:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9ULB4.240.240"}, "ts": "2023-07-06 17:44:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULB4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:44:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08887", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:45:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02445-1"}, "ts": "2023-07-06 17:45:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02445-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 17:45:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34360843", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 17:46:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34360843", "type": "PubMed"}, "ts": "2023-07-06 17:46:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34360843", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 17:46:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P40763.716.716"}, "ts": "2023-07-06 17:46:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40763", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:46:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08575"}, "ts": "2023-07-06 17:47:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46937"}, "ts": "2023-07-06 17:47:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NAM6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:48:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NAM6"}, "ts": "2023-07-06 17:48:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15169.127.127"}, "ts": "2023-07-06 17:48:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15169", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:48:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "feedback", "message": "page access"}, "ts": "2023-07-06 17:49:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G01180ZJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:49:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G01180ZJ"}, "ts": "2023-07-06 17:49:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z3D6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:49:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z3D6"}, "ts": "2023-07-06 17:49:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6MG51", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 17:49:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6MG51"}, "ts": "2023-07-06 17:49:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35248", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:49:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35248"}, "ts": "2023-07-06 17:49:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01857", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:49:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25063", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:49:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96S99", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:49:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96S99"}, "ts": "2023-07-06 17:49:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PB7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:50:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PB7"}, "ts": "2023-07-06 17:50:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75095", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:50:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75095.169.169"}, "ts": "2023-07-06 17:50:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CN5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:50:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CN5"}, "ts": "2023-07-06 17:50:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75122-1"}, "ts": "2023-07-06 17:51:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z6W7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:51:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z6W7"}, "ts": "2023-07-06 17:51:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q56AP7-1"}, "ts": "2023-07-06 17:51:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q56AP7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:51:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91YQ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:51:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2222810", "type": "PubMed"}, "ts": "2023-07-06 17:51:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2222810", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 17:51:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70994MS"}, "ts": "2023-07-06 17:51:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91YQ5"}, "ts": "2023-07-06 17:51:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84083SA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:51:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84083SA"}, "ts": "2023-07-06 17:51:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34884663", "type": "PubMed"}, "ts": "2023-07-06 17:51:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34884663", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 17:51:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G80858MF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:52:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22455", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:52:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49225WK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:52:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G04435PJ"}, "ts": "2023-07-06 17:52:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G04435PJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 17:52:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F8VPP8-1"}, "ts": "2023-07-06 17:52:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F8VPP8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:52:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70582-1"}, "ts": "2023-07-06 17:52:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70582-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:52:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14159-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:52:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14159-1"}, "ts": "2023-07-06 17:52:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13330"}, "ts": "2023-07-06 17:53:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13330", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 17:53:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98082", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:53:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23275"}, "ts": "2023-07-06 17:55:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A9Q0-1"}, "ts": "2023-07-06 17:56:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A9Q0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:56:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3A4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:56:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3A4-1"}, "ts": "2023-07-06 17:56:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RD62-1"}, "ts": "2023-07-06 17:56:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RD62-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:56:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01583"}, "ts": "2023-07-06 17:56:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12660"}, "ts": "2023-07-06 17:56:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q07113"}, "ts": "2023-07-06 17:56:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15371", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:56:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05112", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:56:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05112"}, "ts": "2023-07-06 17:56:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15371.135.135"}, "ts": "2023-07-06 17:56:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60568"}, "ts": "2023-07-06 17:57:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00395"}, "ts": "2023-07-06 17:57:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q925C0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:57:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q925C0-1"}, "ts": "2023-07-06 17:57:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47774", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:57:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47774"}, "ts": "2023-07-06 17:57:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:57:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75093"}, "ts": "2023-07-06 17:57:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75093", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:57:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0CG47", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:57:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P0CG47.24.24"}, "ts": "2023-07-06 17:57:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5S9.42.42"}, "ts": "2023-07-06 17:57:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5S9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:57:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21575", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:57:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21575"}, "ts": "2023-07-06 17:57:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14914"}, "ts": "2023-07-06 17:57:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14914", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 17:58:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:58:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N2G8"}, "ts": "2023-07-06 17:58:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N2G8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:58:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:59:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12235"}, "ts": "2023-07-06 17:59:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12235", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:59:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 17:59:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DB15"}, "ts": "2023-07-06 17:59:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DB15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 17:59:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJQ1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 17:59:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UJQ1.35.35"}, "ts": "2023-07-06 17:59:39 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-06 18:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-06 18:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 18:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-06 18:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-06 18:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-06 18:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A7Q5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 18:00:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A7Q5"}, "ts": "2023-07-06 18:00:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35052", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:00:30 EDT-0400"}, {"api": "/data/detail_download/", "req": {"id": "P12235", "download_type": "protein_detail", "format": "json", "compressed": false}, "ts": "2023-07-06 18:00:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12235", "user": "Undecided", "type": "user", "page": "protein", "message": "json"}, "ts": "2023-07-06 18:00:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZBM4-1"}, "ts": "2023-07-06 18:00:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZBM4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:01:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11485996", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 18:01:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11485996", "type": "PubMed"}, "ts": "2023-07-06 18:01:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y487", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 18:01:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y487.505.505"}, "ts": "2023-07-06 18:01:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21552"}, "ts": "2023-07-06 18:01:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21552", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 18:01:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35092", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:02:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35092"}, "ts": "2023-07-06 18:02:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14543-1"}, "ts": "2023-07-06 18:02:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 18:02:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10721.703.703"}, "ts": "2023-07-06 18:02:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10721", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 18:02:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0N4SUJ3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:02:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0N4SUJ3-1"}, "ts": "2023-07-06 18:02:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:02:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43405-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:02:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43405-1"}, "ts": "2023-07-06 18:02:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08575", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:03:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31433977", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 18:03:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31433977", "type": "PubMed"}, "ts": "2023-07-06 18:03:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 18:03:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46937", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:03:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09382", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:04:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09382"}, "ts": "2023-07-06 18:04:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G93666QU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 18:04:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G93666QU"}, "ts": "2023-07-06 18:04:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5QNW6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:04:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A8H1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:04:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A8H1-1"}, "ts": "2023-07-06 18:04:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZBM4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:04:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZBM4-1"}, "ts": "2023-07-06 18:04:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 18:05:00 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8IZY2", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 18:05:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZY2", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 18:05:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03145", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:05:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03145"}, "ts": "2023-07-06 18:05:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02413"}, "ts": "2023-07-06 18:05:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02413", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:05:06 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05189JQ"}, "ts": "2023-07-06 18:05:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05189JQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 18:05:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02787-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 18:05:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02787-1.630.630"}, "ts": "2023-07-06 18:05:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G08577ZR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 18:05:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G08577ZR"}, "ts": "2023-07-06 18:05:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BRC7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:05:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BRC7"}, "ts": "2023-07-06 18:05:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DAW6"}, "ts": "2023-07-06 18:06:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DAW6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:06:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13698", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 18:06:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13698.37.37"}, "ts": "2023-07-06 18:06:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N3C7"}, "ts": "2023-07-06 18:06:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96SJ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:06:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96SJ8"}, "ts": "2023-07-06 18:06:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8143856", "type": "PubMed"}, "ts": "2023-07-06 18:06:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8143856", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 18:06:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10608"}, "ts": "2023-07-06 18:06:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10608", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:06:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XI50-1"}, "ts": "2023-07-06 18:07:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XI50-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:07:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75122-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:07:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y519"}, "ts": "2023-07-06 18:07:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y519", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:07:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24394"}, "ts": "2023-07-06 18:07:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RB12-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:08:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RB12-1"}, "ts": "2023-07-06 18:08:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21454679", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 18:09:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21454679", "type": "PubMed"}, "ts": "2023-07-06 18:09:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22002060", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 18:09:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22002060", "type": "PubMed"}, "ts": "2023-07-06 18:09:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13473", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 18:09:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13473"}, "ts": "2023-07-06 18:09:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G09416DG"}, "ts": "2023-07-06 18:10:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G09416DG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 18:10:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26897", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 18:10:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26897"}, "ts": "2023-07-06 18:10:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56528"}, "ts": "2023-07-06 18:10:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56528", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:10:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R1E9-1"}, "ts": "2023-07-06 18:11:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R1E9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:11:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22298428", "type": "PubMed"}, "ts": "2023-07-06 18:11:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22298428", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 18:11:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23275", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:11:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P38649"}, "ts": "2023-07-06 18:11:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38649", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 18:11:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G63001DW"}, "ts": "2023-07-06 18:12:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G63001DW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 18:12:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12660", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:12:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TF66", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:12:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:12:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TF66"}, "ts": "2023-07-06 18:12:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-06 18:12:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-06 18:12:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-06 18:12:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07113", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:12:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33506435", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 18:12:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33506435", "type": "PubMed"}, "ts": "2023-07-06 18:12:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33506435", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 18:12:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N158", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 18:12:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N158"}, "ts": "2023-07-06 18:12:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60568", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:13:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RBT4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:13:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RBT4-1"}, "ts": "2023-07-06 18:13:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00395", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:13:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86UW8"}, "ts": "2023-07-06 18:14:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UW8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:14:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14814"}, "ts": "2023-07-06 18:14:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K129-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:14:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K129-1"}, "ts": "2023-07-06 18:15:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:15:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RQY6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:15:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RQY6-1"}, "ts": "2023-07-06 18:15:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NUM4.256.256"}, "ts": "2023-07-06 18:15:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 18:15:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUM4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 18:15:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25490"}, "ts": "2023-07-06 18:15:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CIZ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:16:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CIZ8"}, "ts": "2023-07-06 18:16:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G63565MO"}, "ts": "2023-07-06 18:16:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G63565MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 18:16:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RXQ2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 18:16:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RXQ2"}, "ts": "2023-07-06 18:16:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y692"}, "ts": "2023-07-06 18:17:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y692", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 18:17:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 18:17:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23144454", "type": "PubMed"}, "ts": "2023-07-06 18:17:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23144454", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 18:17:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13813-1"}, "ts": "2023-07-06 18:17:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13813-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:17:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14543-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:17:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43474"}, "ts": "2023-07-06 18:18:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43474", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:18:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q504Y2"}, "ts": "2023-07-06 18:18:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q504Y2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:18:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P50548.20.20"}, "ts": "2023-07-06 18:18:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50548", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 18:18:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-06 18:18:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95319", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:18:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95319"}, "ts": "2023-07-06 18:18:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96H72", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:19:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96H72"}, "ts": "2023-07-06 18:19:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06858"}, "ts": "2023-07-06 18:19:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UW32"}, "ts": "2023-07-06 18:20:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UW32", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 18:20:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUI6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:20:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QUI6"}, "ts": "2023-07-06 18:20:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08582", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:20:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08582"}, "ts": "2023-07-06 18:20:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7L1I2"}, "ts": "2023-07-06 18:21:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L1I2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:21:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18042454", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 18:21:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18042454", "type": "PubMed"}, "ts": "2023-07-06 18:21:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35626", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:21:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35626"}, "ts": "2023-07-06 18:21:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09803"}, "ts": "2023-07-06 18:21:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09803", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:21:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01101-1"}, "ts": "2023-07-06 18:21:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01101-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:21:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62141", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:21:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62141"}, "ts": "2023-07-06 18:21:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12645"}, "ts": "2023-07-06 18:21:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12645", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 18:21:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43004", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 18:22:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P43004.157.157"}, "ts": "2023-07-06 18:22:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02223", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:22:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02223"}, "ts": "2023-07-06 18:22:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2J2"}, "ts": "2023-07-06 18:22:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H467", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:22:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZTU1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:22:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZTU1-1"}, "ts": "2023-07-06 18:22:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H467"}, "ts": "2023-07-06 18:22:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2J2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:22:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3C7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:22:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q562C7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:22:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q562C7"}, "ts": "2023-07-06 18:22:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31270966", "type": "PubMed"}, "ts": "2023-07-06 18:22:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31270966", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 18:22:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5G5D5"}, "ts": "2023-07-06 18:23:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5G5D5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:23:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O19443-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:23:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O19443-1"}, "ts": "2023-07-06 18:23:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G97814YJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 18:23:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G97814YJ"}, "ts": "2023-07-06 18:23:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24394", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:23:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K7V7-1"}, "ts": "2023-07-06 18:24:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K7V7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:24:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NBJ4"}, "ts": "2023-07-06 18:24:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NBJ4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:24:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00966"}, "ts": "2023-07-06 18:24:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UK00-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 18:25:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UK00-1"}, "ts": "2023-07-06 18:25:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UXI9.456.456"}, "ts": "2023-07-06 18:25:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXI9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 18:25:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12109", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:25:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12109"}, "ts": "2023-07-06 18:25:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20817"}, "ts": "2023-07-06 18:25:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20817", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:26:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14195.205.205"}, "ts": "2023-07-06 18:26:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14195", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 18:26:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97613-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:26:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97613-1"}, "ts": "2023-07-06 18:26:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7651534", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 18:26:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7651534", "type": "PubMed"}, "ts": "2023-07-06 18:26:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NUM4.183.183"}, "ts": "2023-07-06 18:26:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:27:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0CG40", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:27:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0CG40"}, "ts": "2023-07-06 18:27:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4AEJ0-1"}, "ts": "2023-07-06 18:27:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4AEJ0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:27:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 18:27:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4AB13-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:28:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4AB13-1"}, "ts": "2023-07-06 18:28:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20083122", "type": "PubMed"}, "ts": "2023-07-06 18:28:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20083122", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 18:28:40 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 18:28:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R4V1"}, "ts": "2023-07-06 18:28:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R4V1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:28:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 18:28:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 18:28:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29288"}, "ts": "2023-07-06 18:28:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29288", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:29:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-06 18:29:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80XZ1-1"}, "ts": "2023-07-06 18:30:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80XZ1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:30:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDU9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:30:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:30:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96IX5"}, "ts": "2023-07-06 18:30:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96IX5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:30:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22607"}, "ts": "2023-07-06 18:30:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDU9"}, "ts": "2023-07-06 18:30:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14814", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:30:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWV2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:30:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UWV2"}, "ts": "2023-07-06 18:30:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18653781", "type": "PubMed"}, "ts": "2023-07-06 18:30:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18653781", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 18:30:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N149.281.281"}, "ts": "2023-07-06 18:31:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N149", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 18:31:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92890"}, "ts": "2023-07-06 18:31:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92890", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:31:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 18:31:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "16537924"}, "ts": "2023-07-06 18:31:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 18:31:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25490", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:31:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U3C3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:31:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U3C3"}, "ts": "2023-07-06 18:31:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35274"}, "ts": "2023-07-06 18:32:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35274", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:32:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WY91", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:34:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WY91"}, "ts": "2023-07-06 18:34:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZTK0-1"}, "ts": "2023-07-06 18:34:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZTK0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:34:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14493", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:34:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14493"}, "ts": "2023-07-06 18:34:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06858", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:35:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WTS8-1"}, "ts": "2023-07-06 18:35:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WTS8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:35:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13541-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:36:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13541-1"}, "ts": "2023-07-06 18:36:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3KP22"}, "ts": "2023-07-06 18:36:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3KP22", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:36:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G91023GB"}, "ts": "2023-07-06 18:37:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61020-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:37:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61020-1"}, "ts": "2023-07-06 18:37:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G16107MY"}, "ts": "2023-07-06 18:37:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G16107MY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 18:37:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95801", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:37:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95801"}, "ts": "2023-07-06 18:37:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23945"}, "ts": "2023-07-06 18:37:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4PP99-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:37:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4PP99-1"}, "ts": "2023-07-06 18:37:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02562EQ"}, "ts": "2023-07-06 18:37:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02562EQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 18:38:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z3D6"}, "ts": "2023-07-06 18:38:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z3D6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:38:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62910", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 18:38:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q62910.1175.1175"}, "ts": "2023-07-06 18:38:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V7L5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:39:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V7L5-1"}, "ts": "2023-07-06 18:39:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6URW6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 18:39:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6URW6"}, "ts": "2023-07-06 18:39:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00966", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:40:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXI8"}, "ts": "2023-07-06 18:40:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXI8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 18:40:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NM03"}, "ts": "2023-07-06 18:40:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NM03", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:40:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "18287559"}, "ts": "2023-07-06 18:40:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16442"}, "ts": "2023-07-06 18:41:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TCW9"}, "ts": "2023-07-06 18:41:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TCW9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:41:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00751-1"}, "ts": "2023-07-06 18:42:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00751-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:42:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 18:42:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q93008.2443.2443"}, "ts": "2023-07-06 18:42:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q93008", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 18:42:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01732"}, "ts": "2023-07-06 18:42:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80UZ2-1"}, "ts": "2023-07-06 18:43:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80UZ2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:43:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WW33"}, "ts": "2023-07-06 18:44:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19818618", "type": "PubMed"}, "ts": "2023-07-06 18:44:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19818618", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 18:44:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25445"}, "ts": "2023-07-06 18:44:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C5J1"}, "ts": "2023-07-06 18:44:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C5J1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:44:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9401003", "type": "PubMed"}, "ts": "2023-07-06 18:44:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9401003", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 18:44:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4V8G8"}, "ts": "2023-07-06 18:44:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q925F2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:45:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q925F2"}, "ts": "2023-07-06 18:45:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UM01"}, "ts": "2023-07-06 18:45:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UM01", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:45:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:45:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14798", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 18:45:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14798.156.156"}, "ts": "2023-07-06 18:45:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92575", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 18:45:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 18:45:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q9K8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:45:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9Q9K8-1"}, "ts": "2023-07-06 18:45:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92575"}, "ts": "2023-07-06 18:45:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22607", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:46:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5HYC2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:46:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5HYC2"}, "ts": "2023-07-06 18:46:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14514", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 18:46:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14514.159.159"}, "ts": "2023-07-06 18:46:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8444322", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 18:47:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8444322", "type": "PubMed"}, "ts": "2023-07-06 18:47:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15625120", "type": "PubMed"}, "ts": "2023-07-06 18:47:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15625120", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 18:47:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q75NI5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:47:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q75NI5-1"}, "ts": "2023-07-06 18:47:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q69ZK6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:47:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q69ZK6-1"}, "ts": "2023-07-06 18:47:48 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05344FK"}, "ts": "2023-07-06 18:48:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05344FK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 18:48:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A806-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:48:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A806-1"}, "ts": "2023-07-06 18:48:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13905", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:49:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13905"}, "ts": "2023-07-06 18:49:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51805.409.409"}, "ts": "2023-07-06 18:49:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51805", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 18:49:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46459"}, "ts": "2023-07-06 18:49:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15052"}, "ts": "2023-07-06 18:49:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15052", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:49:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15591535", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 18:49:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15591535", "type": "PubMed"}, "ts": "2023-07-06 18:49:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06981MP"}, "ts": "2023-07-06 18:50:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06981MP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 18:50:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01023", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 18:50:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01023.719.719"}, "ts": "2023-07-06 18:50:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00051MO"}, "ts": "2023-07-06 18:50:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00051MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 18:50:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P39059"}, "ts": "2023-07-06 18:50:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P39059"}, "ts": "2023-07-06 18:50:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00241.178.178"}, "ts": "2023-07-06 18:50:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00241", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 18:50:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96B23", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:51:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96B23"}, "ts": "2023-07-06 18:51:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UGP4"}, "ts": "2023-07-06 18:51:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5DU09"}, "ts": "2023-07-06 18:51:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5DU09", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 18:51:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGP4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:51:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35222"}, "ts": "2023-07-06 18:51:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A740-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:51:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A740-1"}, "ts": "2023-07-06 18:51:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15118", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 18:52:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00021MO"}, "ts": "2023-07-06 18:52:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00021MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 18:52:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15118.116.116"}, "ts": "2023-07-06 18:52:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01730"}, "ts": "2023-07-06 18:52:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:53:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01730", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:53:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56745-1"}, "ts": "2023-07-06 18:53:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56745-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:53:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G93646CO"}, "ts": "2023-07-06 18:53:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G93646CO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 18:53:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G91023GB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 18:53:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23945", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:53:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q925U0-1"}, "ts": "2023-07-06 18:53:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q925U0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:53:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88588-1"}, "ts": "2023-07-06 18:53:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88588-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:54:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61121"}, "ts": "2023-07-06 18:55:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61121", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 18:56:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16566"}, "ts": "2023-07-06 18:56:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11435693", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 18:56:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11435693", "type": "PubMed"}, "ts": "2023-07-06 18:56:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F7EXV6-1"}, "ts": "2023-07-06 18:57:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F7EXV6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:57:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16442", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:57:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NWK9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 18:57:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NWK9.367.367"}, "ts": "2023-07-06 18:57:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16775"}, "ts": "2023-07-06 18:57:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16775", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 18:57:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12643"}, "ts": "2023-07-06 18:57:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4VAC9"}, "ts": "2023-07-06 18:57:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4VAC9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:57:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8737292", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 18:58:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8737292", "type": "PubMed"}, "ts": "2023-07-06 18:58:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9654073", "type": "PubMed"}, "ts": "2023-07-06 18:58:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9654073", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 18:58:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4D1"}, "ts": "2023-07-06 18:58:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4D1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:58:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WTL3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:58:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WTL3-1"}, "ts": "2023-07-06 18:58:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01732", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:58:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21581"}, "ts": "2023-07-06 18:59:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:59:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26992", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:59:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26992"}, "ts": "2023-07-06 18:59:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G13971OJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 18:59:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G13971OJ"}, "ts": "2023-07-06 18:59:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56818", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 18:59:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56818"}, "ts": "2023-07-06 18:59:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16275905", "type": "PubMed"}, "ts": "2023-07-06 19:00:01 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-06 19:00:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16275905", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-06 19:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 19:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-06 19:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-06 19:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-06 19:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZH34-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:00:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y519"}, "ts": "2023-07-06 19:00:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZH34-1"}, "ts": "2023-07-06 19:00:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25445", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:00:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y519", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:00:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ESQ5-1"}, "ts": "2023-07-06 19:00:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ESQ5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:00:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18584GV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:00:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18584GV"}, "ts": "2023-07-06 19:00:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96HS1"}, "ts": "2023-07-06 19:00:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96HS1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:00:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4V8G8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:00:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51665", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:00:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51665.25.25"}, "ts": "2023-07-06 19:00:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17050-1"}, "ts": "2023-07-06 19:01:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96LB1-1"}, "ts": "2023-07-06 19:01:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96LB1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:01:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14765", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:01:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14765.173.173"}, "ts": "2023-07-06 19:01:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P6T9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:01:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P6T9-1"}, "ts": "2023-07-06 19:01:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22449-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:01:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22449-1"}, "ts": "2023-07-06 19:01:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80294ZS"}, "ts": "2023-07-06 19:01:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UI17"}, "ts": "2023-07-06 19:01:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UI17", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 19:01:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2585506", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:02:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2585506", "type": "PubMed"}, "ts": "2023-07-06 19:02:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WTZ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:02:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WTZ8"}, "ts": "2023-07-06 19:02:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02745-1"}, "ts": "2023-07-06 19:02:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02745-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:02:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7634325", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:03:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7634325", "type": "PubMed"}, "ts": "2023-07-06 19:03:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04040"}, "ts": "2023-07-06 19:03:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17813"}, "ts": "2023-07-06 19:03:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17813", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:03:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00488"}, "ts": "2023-07-06 19:03:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G80123RH"}, "ts": "2023-07-06 19:04:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G80123RH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:04:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A9R9W0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:04:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A9R9W0-1"}, "ts": "2023-07-06 19:04:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53992"}, "ts": "2023-07-06 19:04:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D6X6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:04:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:04:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16410"}, "ts": "2023-07-06 19:04:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16410", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:05:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D6X6"}, "ts": "2023-07-06 19:05:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46459", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:05:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CQM5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 19:05:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CQM5"}, "ts": "2023-07-06 19:05:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37275"}, "ts": "2023-07-06 19:05:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZQV8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:05:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZQV8-1"}, "ts": "2023-07-06 19:05:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZJ29-1"}, "ts": "2023-07-06 19:05:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZJ29-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:06:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68FL6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:06:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68FL6"}, "ts": "2023-07-06 19:06:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:06:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12972431", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:06:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12972431", "type": "PubMed"}, "ts": "2023-07-06 19:06:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3KNW5"}, "ts": "2023-07-06 19:06:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3KNW5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:06:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01876"}, "ts": "2023-07-06 19:06:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13112", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:06:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13112.433.433"}, "ts": "2023-07-06 19:06:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4AA49-1"}, "ts": "2023-07-06 19:06:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4AA49-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:06:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39059", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:06:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39059", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:06:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22756", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:06:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22756"}, "ts": "2023-07-06 19:06:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29931IJ"}, "ts": "2023-07-06 19:07:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53434XO"}, "ts": "2023-07-06 19:07:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-06 19:07:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35029YA"}, "ts": "2023-07-06 19:07:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57317CE"}, "ts": "2023-07-06 19:07:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73004SD"}, "ts": "2023-07-06 19:07:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-06 19:07:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58001LT"}, "ts": "2023-07-06 19:07:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:07:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19835", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:07:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P19835.640.640"}, "ts": "2023-07-06 19:07:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RCD6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:07:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RCD6-1"}, "ts": "2023-07-06 19:07:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZNL0-1"}, "ts": "2023-07-06 19:07:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZNL0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:07:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56856"}, "ts": "2023-07-06 19:07:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7637590", "type": "PubMed"}, "ts": "2023-07-06 19:07:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7637590", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:07:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35222", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:07:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54762-1"}, "ts": "2023-07-06 19:07:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54762-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:07:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14047PA"}, "ts": "2023-07-06 19:07:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRR5"}, "ts": "2023-07-06 19:08:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRR5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:08:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02452"}, "ts": "2023-07-06 19:08:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G36660PJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:08:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G36660PJ"}, "ts": "2023-07-06 19:08:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13508"}, "ts": "2023-07-06 19:08:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13508", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:08:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VGA9"}, "ts": "2023-07-06 19:09:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VGA9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 19:09:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y617", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:09:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y617.21.21"}, "ts": "2023-07-06 19:09:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4LE39-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:10:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4LE39-1"}, "ts": "2023-07-06 19:10:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8262053", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:10:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8262053", "type": "PubMed"}, "ts": "2023-07-06 19:10:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41221", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:10:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P41221.170.170"}, "ts": "2023-07-06 19:10:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G55220VL"}, "ts": "2023-07-06 19:11:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:11:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18507", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:11:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18507"}, "ts": "2023-07-06 19:11:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60981-1"}, "ts": "2023-07-06 19:11:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LZ08-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:11:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LZ08-1"}, "ts": "2023-07-06 19:11:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G19865KY"}, "ts": "2023-07-06 19:12:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G19865KY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:12:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y493", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:12:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16566", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:12:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NSA1.124.124"}, "ts": "2023-07-06 19:12:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NSA1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:12:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y493"}, "ts": "2023-07-06 19:12:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29812"}, "ts": "2023-07-06 19:12:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29812", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 19:12:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G98596OT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:13:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G98596OT"}, "ts": "2023-07-06 19:13:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12643", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:13:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11309-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:13:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11309-1"}, "ts": "2023-07-06 19:13:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14674.816.816"}, "ts": "2023-07-06 19:13:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14674", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:13:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 19:13:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15113", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 19:13:58 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q15113", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 19:13:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15113", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 19:13:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13641", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:14:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13641"}, "ts": "2023-07-06 19:14:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q63279.67.67"}, "ts": "2023-07-06 19:14:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63279", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:14:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N114", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:14:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N114"}, "ts": "2023-07-06 19:14:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21581", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:15:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPD5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:15:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPD5"}, "ts": "2023-07-06 19:15:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14093.71.71"}, "ts": "2023-07-06 19:15:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14093", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:15:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06157WU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:16:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06157WU"}, "ts": "2023-07-06 19:16:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K8Z0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:16:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K8Z0-1"}, "ts": "2023-07-06 19:16:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "K7N6J5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:16:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "K7N6J5-1"}, "ts": "2023-07-06 19:16:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52564", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:16:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P52564.95.95"}, "ts": "2023-07-06 19:16:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17050-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:17:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G59034PL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:17:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:17:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G59034PL"}, "ts": "2023-07-06 19:17:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47871", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:17:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47871"}, "ts": "2023-07-06 19:17:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q75NI5-1"}, "ts": "2023-07-06 19:17:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:18:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TEW0"}, "ts": "2023-07-06 19:18:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TEW0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:18:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4AAR3-1"}, "ts": "2023-07-06 19:18:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CN7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 19:18:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CN7"}, "ts": "2023-07-06 19:18:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 19:19:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04040", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:19:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17931", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:19:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17931.6.6"}, "ts": "2023-07-06 19:19:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15155.362.362"}, "ts": "2023-07-06 19:19:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15155", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:19:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2F5"}, "ts": "2023-07-06 19:19:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2F5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:19:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00488", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:19:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V7W1"}, "ts": "2023-07-06 19:19:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V7W1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 19:19:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZXL1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:19:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZXL1-1"}, "ts": "2023-07-06 19:19:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDN7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:19:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDN7-1"}, "ts": "2023-07-06 19:19:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68FP2"}, "ts": "2023-07-06 19:19:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68FP2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:20:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07756-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:20:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07756-1"}, "ts": "2023-07-06 19:20:08 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05187WH"}, "ts": "2023-07-06 19:20:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05187WH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:20:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53992", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:20:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JQC4"}, "ts": "2023-07-06 19:20:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JQC4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:20:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05060ST"}, "ts": "2023-07-06 19:20:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05060ST", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:20:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08922", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:20:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08922.729.729"}, "ts": "2023-07-06 19:20:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6TXF1-1"}, "ts": "2023-07-06 19:21:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6TXF1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:21:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJW7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:21:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJW7"}, "ts": "2023-07-06 19:21:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NBS3"}, "ts": "2023-07-06 19:21:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NBS3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:21:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37275", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:21:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32626996", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:21:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32626996", "type": "PubMed"}, "ts": "2023-07-06 19:21:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBG0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:21:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBG0"}, "ts": "2023-07-06 19:22:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02766"}, "ts": "2023-07-06 19:22:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01876", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:22:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZI7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:22:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZI7"}, "ts": "2023-07-06 19:22:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CIZ8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:22:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56856", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:23:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "W4VSN8"}, "ts": "2023-07-06 19:23:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "W4VSN8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:23:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AYZ1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:23:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AYZ1-1"}, "ts": "2023-07-06 19:23:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12824491", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:23:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12824491", "type": "PubMed"}, "ts": "2023-07-06 19:23:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G14047PA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:23:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02452", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:24:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K9K2"}, "ts": "2023-07-06 19:25:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K9K2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 19:25:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CIZ8-1"}, "ts": "2023-07-06 19:25:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CW9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:25:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CW9"}, "ts": "2023-07-06 19:25:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G69408QG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:25:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G69408QG"}, "ts": "2023-07-06 19:25:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P19878.356.356"}, "ts": "2023-07-06 19:26:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19878", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:26:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31315927", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:26:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31315927", "type": "PubMed"}, "ts": "2023-07-06 19:26:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P80386-1"}, "ts": "2023-07-06 19:26:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80386-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:26:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21860"}, "ts": "2023-07-06 19:26:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULE6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:27:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9ULE6.427.427"}, "ts": "2023-07-06 19:27:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G55220VL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:27:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:27:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDB6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:27:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDB6"}, "ts": "2023-07-06 19:27:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16519681", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:27:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:27:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16519681", "type": "PubMed"}, "ts": "2023-07-06 19:27:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60981-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:27:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IQ49", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:28:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6IQ49.59.59"}, "ts": "2023-07-06 19:28:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07682PQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:28:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07682PQ"}, "ts": "2023-07-06 19:28:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04837", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:28:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q04837.107.107"}, "ts": "2023-07-06 19:28:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q18PE1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 19:28:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q18PE1"}, "ts": "2023-07-06 19:28:51 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P63269", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 19:29:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63269", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 19:29:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63269", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 19:29:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33330937", "type": "PubMed"}, "ts": "2023-07-06 19:29:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33330937", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:29:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17858.399.399"}, "ts": "2023-07-06 19:29:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17858", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:29:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00560"}, "ts": "2023-07-06 19:29:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55314-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:29:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55314-1"}, "ts": "2023-07-06 19:29:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96BF6"}, "ts": "2023-07-06 19:29:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BF6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:29:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06213"}, "ts": "2023-07-06 19:29:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RD45-1"}, "ts": "2023-07-06 19:30:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RD45-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:30:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19463982", "type": "PubMed"}, "ts": "2023-07-06 19:30:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19463982", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:30:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K4Z2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:30:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8K4Z2.36.36"}, "ts": "2023-07-06 19:30:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NS98.46.46"}, "ts": "2023-07-06 19:31:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NS98", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:31:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10321732", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:31:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10321732", "type": "PubMed"}, "ts": "2023-07-06 19:31:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F8WLE0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:31:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F8WLE0-1"}, "ts": "2023-07-06 19:31:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28130445", "type": "PubMed"}, "ts": "2023-07-06 19:31:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28130445", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:31:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00222", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:31:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00222.193.193"}, "ts": "2023-07-06 19:31:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6AZY7.257.257"}, "ts": "2023-07-06 19:31:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AZY7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:31:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43808.199.199"}, "ts": "2023-07-06 19:31:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43808", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:31:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CZR4"}, "ts": "2023-07-06 19:32:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CZR4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 19:32:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G09074CE"}, "ts": "2023-07-06 19:32:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G09074CE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:32:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96QU4"}, "ts": "2023-07-06 19:32:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QU4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 19:32:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34135160", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:32:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34135160", "type": "PubMed"}, "ts": "2023-07-06 19:32:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02745-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:32:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02745-1"}, "ts": "2023-07-06 19:32:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92823", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:32:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92823.639.639"}, "ts": "2023-07-06 19:32:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "about", "message": "page access"}, "ts": "2023-07-06 19:32:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "about", "message": "page access"}, "ts": "2023-07-06 19:32:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 19:32:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BSQ5"}, "ts": "2023-07-06 19:32:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G90769IN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:32:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G90769IN"}, "ts": "2023-07-06 19:32:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BSQ5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 19:32:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:32:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WTW4-1"}, "ts": "2023-07-06 19:32:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WTW4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:33:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QU1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:33:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92953", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:33:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92953.560.560"}, "ts": "2023-07-06 19:33:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96QU1"}, "ts": "2023-07-06 19:33:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z1R4"}, "ts": "2023-07-06 19:33:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1R4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:33:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8568869", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:33:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8568869", "type": "PubMed"}, "ts": "2023-07-06 19:33:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32576659", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:33:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32576659", "type": "PubMed"}, "ts": "2023-07-06 19:33:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22283-1"}, "ts": "2023-07-06 19:33:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22283-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:33:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JVI4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 19:34:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JVI4"}, "ts": "2023-07-06 19:34:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91ZV3"}, "ts": "2023-07-06 19:34:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91ZV3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:34:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01871"}, "ts": "2023-07-06 19:34:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01871", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:34:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86UW8.24.24"}, "ts": "2023-07-06 19:34:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6A009-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:34:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6A009-1"}, "ts": "2023-07-06 19:34:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UW8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:34:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15322187", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:34:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15322187", "type": "PubMed"}, "ts": "2023-07-06 19:34:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17689DH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:34:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G81983KG"}, "ts": "2023-07-06 19:35:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G81983KG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:35:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47825-1"}, "ts": "2023-07-06 19:35:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47825-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:35:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:35:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 19:35:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:35:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02656-1"}, "ts": "2023-07-06 19:35:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02656-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:36:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25038051", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:36:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25038051", "type": "PubMed"}, "ts": "2023-07-06 19:36:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01614ZM"}, "ts": "2023-07-06 19:36:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-06 19:36:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17015OC"}, "ts": "2023-07-06 19:36:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29931IJ"}, "ts": "2023-07-06 19:36:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-06 19:36:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65562ZE"}, "ts": "2023-07-06 19:36:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68008QO"}, "ts": "2023-07-06 19:36:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74722FL"}, "ts": "2023-07-06 19:36:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81006GJ"}, "ts": "2023-07-06 19:36:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A8E5-1"}, "ts": "2023-07-06 19:37:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A8E5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:37:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TBC4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:37:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TBC4"}, "ts": "2023-07-06 19:37:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06021WU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:37:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06021WU"}, "ts": "2023-07-06 19:37:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CQS7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 19:37:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CQS7"}, "ts": "2023-07-06 19:37:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:38:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G87051GH"}, "ts": "2023-07-06 19:38:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G87051GH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:38:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02766", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:38:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z6M3.157.157"}, "ts": "2023-07-06 19:38:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z6M3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:38:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99805"}, "ts": "2023-07-06 19:38:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y277"}, "ts": "2023-07-06 19:38:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1660188", "type": "PubMed"}, "ts": "2023-07-06 19:39:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1660188", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:39:12 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P54819", "cluster_type": "unselected"}, "ts": "2023-07-06 19:39:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54819", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 19:39:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZAG6"}, "ts": "2023-07-06 19:39:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZAG6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:39:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20533528", "type": "PubMed"}, "ts": "2023-07-06 19:39:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20533528", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:39:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWV3"}, "ts": "2023-07-06 19:40:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWV3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 19:40:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2X0"}, "ts": "2023-07-06 19:40:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2X0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:40:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43827", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:40:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43827"}, "ts": "2023-07-06 19:40:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYE9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 19:40:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYE9"}, "ts": "2023-07-06 19:40:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYV4"}, "ts": "2023-07-06 19:40:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYV4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:41:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50990-1"}, "ts": "2023-07-06 19:41:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99805", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:41:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y277", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:41:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WZ42", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:41:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q702N8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:42:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q702N8"}, "ts": "2023-07-06 19:42:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61914YY"}, "ts": "2023-07-06 19:42:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61914YY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:42:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G90737TF"}, "ts": "2023-07-06 19:42:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G90737TF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:42:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:42:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64583-1"}, "ts": "2023-07-06 19:43:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64583-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:43:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49848", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:43:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49848"}, "ts": "2023-07-06 19:43:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "17875669"}, "ts": "2023-07-06 19:43:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:43:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 19:43:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00231IQ"}, "ts": "2023-07-06 19:44:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00231IQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:44:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WZ42"}, "ts": "2023-07-06 19:44:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P1J9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:44:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TRA6"}, "ts": "2023-07-06 19:45:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35329", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:45:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TRA6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:45:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35329"}, "ts": "2023-07-06 19:45:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:45:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5QE78-1"}, "ts": "2023-07-06 19:45:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5QE78-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:45:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05090-1"}, "ts": "2023-07-06 19:45:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54951-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:45:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54951-1"}, "ts": "2023-07-06 19:45:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15006", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:46:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15006.239.239"}, "ts": "2023-07-06 19:46:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:46:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V9M0-1"}, "ts": "2023-07-06 19:47:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V9M0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:47:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04143-1"}, "ts": "2023-07-06 19:47:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04143-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:47:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UNN8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:47:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UNN8"}, "ts": "2023-07-06 19:47:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKY3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:47:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKY3"}, "ts": "2023-07-06 19:47:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16363", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:47:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16363.233.233"}, "ts": "2023-07-06 19:47:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B3DMA2-1"}, "ts": "2023-07-06 19:48:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B3DMA2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:48:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:48:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15064416", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:48:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15064416", "type": "PubMed"}, "ts": "2023-07-06 19:48:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G90884CI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:48:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G90884CI"}, "ts": "2023-07-06 19:48:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00116"}, "ts": "2023-07-06 19:48:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00116", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:48:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10716"}, "ts": "2023-07-06 19:49:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HBL0-1"}, "ts": "2023-07-06 19:49:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBL0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:49:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28263986", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:49:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28263986", "type": "PubMed"}, "ts": "2023-07-06 19:49:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6RFH4"}, "ts": "2023-07-06 19:49:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6RFH4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:49:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14662855", "type": "PubMed"}, "ts": "2023-07-06 19:50:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14662855", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:50:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G68438GJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:50:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G68438GJ"}, "ts": "2023-07-06 19:50:14 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P29218", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 19:50:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29218", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 19:50:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 19:50:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 19:50:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62910", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 19:50:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62910"}, "ts": "2023-07-06 19:50:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RAK9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:51:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RAK9-1"}, "ts": "2023-07-06 19:51:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TSH6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:51:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TSH6"}, "ts": "2023-07-06 19:51:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G99884YO"}, "ts": "2023-07-06 19:51:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G99884YO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:51:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P9P6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:51:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P9P6"}, "ts": "2023-07-06 19:51:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06250ZP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:51:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06250ZP"}, "ts": "2023-07-06 19:51:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00461RR"}, "ts": "2023-07-06 19:52:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00461RR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:52:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17074-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:52:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17074-1"}, "ts": "2023-07-06 19:52:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZVY8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:52:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZVY8-1"}, "ts": "2023-07-06 19:52:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZKQ7-1"}, "ts": "2023-07-06 19:52:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZKQ7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:52:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07532UC"}, "ts": "2023-07-06 19:53:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07532UC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:53:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14055"}, "ts": "2023-07-06 19:54:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:54:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14055", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:54:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01973"}, "ts": "2023-07-06 19:54:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01973", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:54:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NBZ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:54:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NBZ7"}, "ts": "2023-07-06 19:54:42 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q99990", "cluster_type": "unselected"}, "ts": "2023-07-06 19:54:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99990", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 19:54:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99990", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 19:54:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55061"}, "ts": "2023-07-06 19:55:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55061", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:55:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:55:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-06 19:55:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90348RI"}, "ts": "2023-07-06 19:55:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2A7"}, "ts": "2023-07-06 19:55:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P1J9-1"}, "ts": "2023-07-06 19:55:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86X76-1"}, "ts": "2023-07-06 19:56:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X76-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:56:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63219", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 19:56:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63219"}, "ts": "2023-07-06 19:56:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20266-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:56:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20266-1"}, "ts": "2023-07-06 19:56:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NUN7"}, "ts": "2023-07-06 19:56:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUN7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:56:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23103875", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:57:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23103875", "type": "PubMed"}, "ts": "2023-07-06 19:57:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50990-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:57:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70616-1"}, "ts": "2023-07-06 19:57:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70616-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:57:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14157", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:57:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14157.714.714"}, "ts": "2023-07-06 19:57:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61250GU"}, "ts": "2023-07-06 19:57:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61250GU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:57:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJV9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:58:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UJV9.75.75"}, "ts": "2023-07-06 19:58:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02671.246.246"}, "ts": "2023-07-06 19:58:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02671", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 19:58:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A1N8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 19:59:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A1N8-1"}, "ts": "2023-07-06 19:59:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G63059VZ"}, "ts": "2023-07-06 19:59:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G63059VZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 19:59:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "6192908", "type": "PubMed"}, "ts": "2023-07-06 19:59:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6192908", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 19:59:28 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-06 20:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-06 20:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 20:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-06 20:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-06 20:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-06 20:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43399"}, "ts": "2023-07-06 20:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43399", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:00:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WYN3"}, "ts": "2023-07-06 20:00:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WYN3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:00:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UPN3.1122.1122"}, "ts": "2023-07-06 20:01:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPN3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:01:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00977CB"}, "ts": "2023-07-06 20:01:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G37881RL"}, "ts": "2023-07-06 20:01:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00977CB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:01:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05090-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:01:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06228CC"}, "ts": "2023-07-06 20:01:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06228CC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:01:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14733"}, "ts": "2023-07-06 20:01:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2T6"}, "ts": "2023-07-06 20:02:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2T6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:02:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q501W2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:02:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q501W2-1"}, "ts": "2023-07-06 20:02:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92791", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:02:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92791"}, "ts": "2023-07-06 20:02:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20742", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:02:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P20742.1432.1432"}, "ts": "2023-07-06 20:02:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5W3.268.268"}, "ts": "2023-07-06 20:02:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5W3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:02:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R595-1"}, "ts": "2023-07-06 20:03:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R595-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:03:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CG09"}, "ts": "2023-07-06 20:03:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CG09", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:03:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0F3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:04:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G37071WI"}, "ts": "2023-07-06 20:04:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G37071WI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:04:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9C0F3-1"}, "ts": "2023-07-06 20:04:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18853HA"}, "ts": "2023-07-06 20:04:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18853HA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:04:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06213", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:04:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06213.445.445"}, "ts": "2023-07-06 20:04:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWA0", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 20:05:04 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8WWA0", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 20:05:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWA0", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 20:05:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LZH0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:05:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LZH0-1"}, "ts": "2023-07-06 20:05:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10716", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:05:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G46836GH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:05:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G46836GH"}, "ts": "2023-07-06 20:05:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7RTY7"}, "ts": "2023-07-06 20:06:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTY7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:06:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96A65", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:06:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96A65"}, "ts": "2023-07-06 20:06:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59923"}, "ts": "2023-07-06 20:06:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59923", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:06:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q02447.407.407"}, "ts": "2023-07-06 20:06:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02447", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:06:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXC1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:06:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UXC1.427.427"}, "ts": "2023-07-06 20:06:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G11745XZ"}, "ts": "2023-07-06 20:06:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G11745XZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:06:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2C9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:07:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2C9.144.144"}, "ts": "2023-07-06 20:07:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14787.655.655"}, "ts": "2023-07-06 20:07:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14787", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:07:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08649", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:07:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08649"}, "ts": "2023-07-06 20:07:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13867", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:08:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13867"}, "ts": "2023-07-06 20:08:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05231"}, "ts": "2023-07-06 20:08:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULT8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:09:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULT8"}, "ts": "2023-07-06 20:09:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2A7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:09:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:09:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBQ6"}, "ts": "2023-07-06 20:09:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBQ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:09:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10828"}, "ts": "2023-07-06 20:09:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BUR4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:09:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BUR4"}, "ts": "2023-07-06 20:09:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UK55"}, "ts": "2023-07-06 20:09:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UK55", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:09:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00258", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:09:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00258"}, "ts": "2023-07-06 20:09:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:09:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99P99-1"}, "ts": "2023-07-06 20:09:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99P99-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:09:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BJ42", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:10:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8BJ42.743.743"}, "ts": "2023-07-06 20:10:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 20:10:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30538118", "type": "PubMed"}, "ts": "2023-07-06 20:10:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30538118", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 20:10:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:10:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51858", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:10:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51858.165.165"}, "ts": "2023-07-06 20:10:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10361"}, "ts": "2023-07-06 20:11:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYH8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:11:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYH8-1"}, "ts": "2023-07-06 20:11:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25768306", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 20:11:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25768306", "type": "PubMed"}, "ts": "2023-07-06 20:11:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y548", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 20:12:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y548"}, "ts": "2023-07-06 20:12:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05305-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:12:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05305-1"}, "ts": "2023-07-06 20:12:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein_detail.html", "message": "page access"}, "ts": "2023-07-06 20:12:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14590NM"}, "ts": "2023-07-06 20:13:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8623771", "type": "PubMed"}, "ts": "2023-07-06 20:13:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8623771", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 20:13:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2ARA8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:14:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2ARA8"}, "ts": "2023-07-06 20:14:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78310", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:14:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78310"}, "ts": "2023-07-06 20:14:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TH1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:14:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TH1"}, "ts": "2023-07-06 20:14:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G23010ZW"}, "ts": "2023-07-06 20:14:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G23010ZW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:14:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TH1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:14:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TH1"}, "ts": "2023-07-06 20:14:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86XS5"}, "ts": "2023-07-06 20:14:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86XS5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:14:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24539", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:14:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24539"}, "ts": "2023-07-06 20:14:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NZP1"}, "ts": "2023-07-06 20:15:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NZP1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 20:15:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G94559IJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:15:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G94559IJ"}, "ts": "2023-07-06 20:15:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G98187HG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:15:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G98187HG"}, "ts": "2023-07-06 20:15:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G79389NT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:15:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G79389NT"}, "ts": "2023-07-06 20:15:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYW7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:15:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYW7"}, "ts": "2023-07-06 20:15:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00592", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:15:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00592.299.299"}, "ts": "2023-07-06 20:15:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:16:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RD9"}, "ts": "2023-07-06 20:16:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UM01-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:16:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UM01-1"}, "ts": "2023-07-06 20:16:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14745"}, "ts": "2023-07-06 20:16:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14745", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 20:16:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58161NS"}, "ts": "2023-07-06 20:16:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:16:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49582PC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:16:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49582PC"}, "ts": "2023-07-06 20:16:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96GE4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:17:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G37881RL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:17:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10643", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:17:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10643.539.539"}, "ts": "2023-07-06 20:17:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G20983SP"}, "ts": "2023-07-06 20:17:32 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P23097", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 20:17:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23097", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 20:17:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 20:17:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UUV7"}, "ts": "2023-07-06 20:17:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UUV7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:17:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G35139NO"}, "ts": "2023-07-06 20:17:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G35139NO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:17:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01584", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:17:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01584"}, "ts": "2023-07-06 20:17:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14733", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:17:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61412", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:18:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61412"}, "ts": "2023-07-06 20:18:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A4I3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:19:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A4I3-1"}, "ts": "2023-07-06 20:19:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:19:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05089"}, "ts": "2023-07-06 20:19:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05089", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:19:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7430095", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 20:19:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7430095", "type": "PubMed"}, "ts": "2023-07-06 20:19:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6YHK3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:19:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6YHK3"}, "ts": "2023-07-06 20:19:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P58417"}, "ts": "2023-07-06 20:19:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58417", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:19:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:20:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGB4"}, "ts": "2023-07-06 20:20:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGB4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:20:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A4UGR9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:20:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A4UGR9"}, "ts": "2023-07-06 20:20:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59901", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:20:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59901"}, "ts": "2023-07-06 20:20:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02763-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:20:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02763-1.93.93"}, "ts": "2023-07-06 20:20:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14921"}, "ts": "2023-07-06 20:20:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D3R9"}, "ts": "2023-07-06 20:20:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D3R9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 20:20:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12446677", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 20:21:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12446677", "type": "PubMed"}, "ts": "2023-07-06 20:21:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VCD7"}, "ts": "2023-07-06 20:22:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VCD7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:22:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G99801SM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:22:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G99801SM"}, "ts": "2023-07-06 20:22:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C4U2"}, "ts": "2023-07-06 20:22:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C4U2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 20:22:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:22:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35555", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:22:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35555"}, "ts": "2023-07-06 20:22:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55058", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:23:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55058.94.94"}, "ts": "2023-07-06 20:23:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06964XX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:23:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06964XX"}, "ts": "2023-07-06 20:23:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-06 20:23:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33854234", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 20:23:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33854234", "type": "PubMed"}, "ts": "2023-07-06 20:23:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34990340", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 20:23:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34990340", "type": "PubMed"}, "ts": "2023-07-06 20:23:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34990340", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 20:23:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G83633GK"}, "ts": "2023-07-06 20:23:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G83633GK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:23:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06989JN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:24:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06989JN"}, "ts": "2023-07-06 20:24:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84489FR"}, "ts": "2023-07-06 20:24:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84489FR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:24:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05997.796.796"}, "ts": "2023-07-06 20:24:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05997", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:24:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25874", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:24:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25874"}, "ts": "2023-07-06 20:24:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05231", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:24:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12391"}, "ts": "2023-07-06 20:25:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12391", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:25:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10828", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:25:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LTU8-1"}, "ts": "2023-07-06 20:26:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LTU8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:26:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXJ9"}, "ts": "2023-07-06 20:26:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXJ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:26:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UA6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:26:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86UA6"}, "ts": "2023-07-06 20:26:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08842", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:26:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08842.259.259"}, "ts": "2023-07-06 20:26:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37840-1"}, "ts": "2023-07-06 20:27:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R5C9-1"}, "ts": "2023-07-06 20:27:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R5C9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:27:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10361", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:27:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XI53-1"}, "ts": "2023-07-06 20:27:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XI53-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:27:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZJ81-1"}, "ts": "2023-07-06 20:27:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZJ81-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:27:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96B33", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:27:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96B33.19.19"}, "ts": "2023-07-06 20:27:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26095475", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 20:28:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26095475", "type": "PubMed"}, "ts": "2023-07-06 20:28:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62805"}, "ts": "2023-07-06 20:28:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62805", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:28:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99877", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:28:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99877"}, "ts": "2023-07-06 20:28:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65937TS"}, "ts": "2023-07-06 20:29:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30232134", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 20:29:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30232134", "type": "PubMed"}, "ts": "2023-07-06 20:29:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ISB3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:30:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ISB3"}, "ts": "2023-07-06 20:30:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11142", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:30:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11142"}, "ts": "2023-07-06 20:30:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 20:30:10 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P56179", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 20:30:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56179", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 20:30:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PHB0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:30:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PHB0"}, "ts": "2023-07-06 20:30:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "media", "message": "page access"}, "ts": "2023-07-06 20:30:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-06 20:30:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37881RL"}, "ts": "2023-07-06 20:30:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-06 20:30:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-06 20:30:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-06 20:30:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50045TK"}, "ts": "2023-07-06 20:30:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10486CT"}, "ts": "2023-07-06 20:30:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5DTT1"}, "ts": "2023-07-06 20:30:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5DTT1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:30:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VDI9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:30:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VDI9-1"}, "ts": "2023-07-06 20:30:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92847"}, "ts": "2023-07-06 20:31:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20309"}, "ts": "2023-07-06 20:31:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:31:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20309", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:31:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2RU67", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:31:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2RU67"}, "ts": "2023-07-06 20:31:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q394", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:32:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "E9Q394.941.941"}, "ts": "2023-07-06 20:32:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G58161NS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:32:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25305-1"}, "ts": "2023-07-06 20:32:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25305-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:32:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86U70", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:32:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86U70"}, "ts": "2023-07-06 20:32:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99N19", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 20:33:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-06 20:33:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G20983SP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:33:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99N19"}, "ts": "2023-07-06 20:33:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 20:33:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DP23", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 20:33:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DP23"}, "ts": "2023-07-06 20:33:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29416"}, "ts": "2023-07-06 20:34:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29416", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:34:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULK2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:34:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULK2"}, "ts": "2023-07-06 20:34:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZUT9-1"}, "ts": "2023-07-06 20:34:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZUT9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:34:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P24530.200.200"}, "ts": "2023-07-06 20:34:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24530", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:34:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:34:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0I9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:34:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0I9"}, "ts": "2023-07-06 20:34:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DTE8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:35:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DTE8"}, "ts": "2023-07-06 20:35:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1K8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:35:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z1K8"}, "ts": "2023-07-06 20:35:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R7B4-1"}, "ts": "2023-07-06 20:36:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R7B4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:36:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H334", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:36:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H334.427.427"}, "ts": "2023-07-06 20:36:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NTZ6"}, "ts": "2023-07-06 20:36:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NTZ6"}, "ts": "2023-07-06 20:36:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NTZ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:36:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80X82", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:36:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q80X82.1260.1260"}, "ts": "2023-07-06 20:36:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NTZ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:36:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37802"}, "ts": "2023-07-06 20:36:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14921", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:36:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15599"}, "ts": "2023-07-06 20:36:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NER1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:36:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NER1.477.477"}, "ts": "2023-07-06 20:36:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92793-1"}, "ts": "2023-07-06 20:36:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:37:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N2Q7"}, "ts": "2023-07-06 20:37:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N2Q7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:37:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8663601", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 20:37:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8663601", "type": "PubMed"}, "ts": "2023-07-06 20:37:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08662", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:37:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O08662.254.254"}, "ts": "2023-07-06 20:37:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00151", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:37:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00151.117.117"}, "ts": "2023-07-06 20:37:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96K75"}, "ts": "2023-07-06 20:38:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96K75", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:38:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYP8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:38:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYP8-1"}, "ts": "2023-07-06 20:38:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JIT1"}, "ts": "2023-07-06 20:38:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JIT1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:38:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q9F6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:39:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9Q9F6-1"}, "ts": "2023-07-06 20:39:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHI7"}, "ts": "2023-07-06 20:39:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHI7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:39:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C091", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:39:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P0C091.39.39"}, "ts": "2023-07-06 20:39:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94832.189.189"}, "ts": "2023-07-06 20:39:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94832", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:39:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G23347CS"}, "ts": "2023-07-06 20:39:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G23347CS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:39:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92841", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:39:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92841"}, "ts": "2023-07-06 20:39:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51659"}, "ts": "2023-07-06 20:39:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51659", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:39:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26022", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:40:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26022"}, "ts": "2023-07-06 20:40:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95279", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:40:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95279"}, "ts": "2023-07-06 20:40:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P58215"}, "ts": "2023-07-06 20:40:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58215", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:41:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q687X5.97.97"}, "ts": "2023-07-06 20:41:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q687X5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:41:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q704Y3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:41:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q704Y3"}, "ts": "2023-07-06 20:41:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q693B1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:41:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q693B1"}, "ts": "2023-07-06 20:41:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99J87"}, "ts": "2023-07-06 20:41:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99J87", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:41:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28300", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:41:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28300"}, "ts": "2023-07-06 20:41:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:41:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54886", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:41:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54886"}, "ts": "2023-07-06 20:41:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39059", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:42:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P39059.562.562"}, "ts": "2023-07-06 20:42:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D771-1"}, "ts": "2023-07-06 20:42:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D771-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:42:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14373"}, "ts": "2023-07-06 20:42:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70689", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:43:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70689"}, "ts": "2023-07-06 20:43:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP59"}, "ts": "2023-07-06 20:43:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9461541", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 20:43:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9461541", "type": "PubMed"}, "ts": "2023-07-06 20:43:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP59", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:43:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68D06", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:44:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q68D06.657.657"}, "ts": "2023-07-06 20:44:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-06 20:45:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60566", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:45:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60566"}, "ts": "2023-07-06 20:45:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61073"}, "ts": "2023-07-06 20:45:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15018", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:46:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15018"}, "ts": "2023-07-06 20:46:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y267", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:46:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1AR17", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 20:46:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B1AR17"}, "ts": "2023-07-06 20:46:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75410-1"}, "ts": "2023-07-06 20:46:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NCF0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:46:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75410-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:46:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NCF0"}, "ts": "2023-07-06 20:46:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUP9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:46:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-06 20:46:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51174"}, "ts": "2023-07-06 20:46:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92847", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:46:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PB44"}, "ts": "2023-07-06 20:47:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PB44", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:47:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:47:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NFZ0.955.955"}, "ts": "2023-07-06 20:47:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFZ0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:47:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53678-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:47:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53678-1"}, "ts": "2023-07-06 20:47:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29249144", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 20:47:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29249144", "type": "PubMed"}, "ts": "2023-07-06 20:47:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKA2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:47:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKA2"}, "ts": "2023-07-06 20:47:36 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G09503CT"}, "ts": "2023-07-06 20:48:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G09503CT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:48:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RD59-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:48:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RD59-1"}, "ts": "2023-07-06 20:48:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q765I0-1"}, "ts": "2023-07-06 20:48:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q765I0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:48:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K0Q5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:48:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K0Q5-1"}, "ts": "2023-07-06 20:48:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UW49", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:48:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UW49"}, "ts": "2023-07-06 20:48:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q674X7-1"}, "ts": "2023-07-06 20:49:05 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 20:49:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 20:49:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 20:49:14 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-06 20:49:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-06 20:49:22 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 20:49:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88572", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:49:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88572"}, "ts": "2023-07-06 20:49:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "tio2", "user": "Undecided", "type": "user", "page": "quick-search", "message": "Performing Global Search"}, "ts": "2023-07-06 20:49:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 20:49:39 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "tio2"}, "ts": "2023-07-06 20:49:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-06 20:49:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "tio2", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=tio2"}, "ts": "2023-07-06 20:49:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 20:49:48 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 20:49:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11532"}, "ts": "2023-07-06 20:49:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13929", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:50:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13929"}, "ts": "2023-07-06 20:50:07 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q00613", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 20:50:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00613", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 20:50:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04694-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:50:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04694-1"}, "ts": "2023-07-06 20:50:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 20:50:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18690212", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 20:50:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18690212", "type": "PubMed"}, "ts": "2023-07-06 20:50:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G37425NA"}, "ts": "2023-07-06 20:50:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G37425NA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:50:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35573"}, "ts": "2023-07-06 20:50:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35573", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:50:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGY5.194.194"}, "ts": "2023-07-06 20:50:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGY5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:50:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47224-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:51:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47224-1"}, "ts": "2023-07-06 20:51:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 20:51:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9351834", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 20:51:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9351834", "type": "PubMed"}, "ts": "2023-07-06 20:51:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09006", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:51:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09006"}, "ts": "2023-07-06 20:51:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8493914", "type": "PubMed"}, "ts": "2023-07-06 20:52:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8493914", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 20:52:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C460-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:52:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C460-1"}, "ts": "2023-07-06 20:52:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14789.38.38"}, "ts": "2023-07-06 20:52:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14789", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:52:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15599", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:52:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N688", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:52:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N688"}, "ts": "2023-07-06 20:52:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:52:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P253"}, "ts": "2023-07-06 20:52:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P253", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:52:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61575RT"}, "ts": "2023-07-06 20:52:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61575RT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:52:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92793-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:52:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9674649", "type": "PubMed"}, "ts": "2023-07-06 20:53:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P032-1"}, "ts": "2023-07-06 20:53:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9674649", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 20:53:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30153-1"}, "ts": "2023-07-06 20:53:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P032-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:53:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05556"}, "ts": "2023-07-06 20:53:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07585", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:54:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:54:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P07585.211.211"}, "ts": "2023-07-06 20:54:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RA70-1"}, "ts": "2023-07-06 20:54:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RA70-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:54:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13813"}, "ts": "2023-07-06 20:55:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13813", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:55:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24385", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:56:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24385"}, "ts": "2023-07-06 20:56:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29315-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 20:56:12 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P29315-1", "cluster_type": "unselected"}, "ts": "2023-07-06 20:56:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29315-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-06 20:56:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08235", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:56:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08235"}, "ts": "2023-07-06 20:56:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G23214KL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:56:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2L6"}, "ts": "2023-07-06 20:56:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G23214KL"}, "ts": "2023-07-06 20:56:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2L6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:56:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61491DK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:56:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61491DK"}, "ts": "2023-07-06 20:56:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11181563", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 20:57:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11181563", "type": "PubMed"}, "ts": "2023-07-06 20:57:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:57:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DTE4"}, "ts": "2023-07-06 20:57:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DTE4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:57:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14373", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:58:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15021LG"}, "ts": "2023-07-06 20:59:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G08570LJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:59:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G08570LJ"}, "ts": "2023-07-06 20:59:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14206", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:59:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14206.89.89"}, "ts": "2023-07-06 20:59:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13442.178.178"}, "ts": "2023-07-06 20:59:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13442", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 20:59:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21728"}, "ts": "2023-07-06 20:59:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21728", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 20:59:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G03707EH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 20:59:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G03707EH"}, "ts": "2023-07-06 20:59:56 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-06 21:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-06 21:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 21:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-06 21:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-06 21:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-06 21:00:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16317043", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 21:00:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16317043", "type": "PubMed"}, "ts": "2023-07-06 21:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R3T8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:00:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R3T8-1"}, "ts": "2023-07-06 21:00:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60237"}, "ts": "2023-07-06 21:01:17 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000034", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-06 21:01:20 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000034", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-06 21:01:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000034", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-06 21:01:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 21:01:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NV23", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 21:01:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NV23"}, "ts": "2023-07-06 21:01:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000034", "user": "Undecided", "type": "error", "page": "motif", "message": "Network error. motif api call. Mozilla/5.0 (Windows NT 6.1; WOW64) AppleWebKit/534  (KHTML, like Gecko) BingPreview/1.0b"}, "ts": "2023-07-06 21:01:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C0L5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:01:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P0C0L5.1126.1126"}, "ts": "2023-07-06 21:01:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61073", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:01:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10599"}, "ts": "2023-07-06 21:02:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G58475PD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:02:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58475PD"}, "ts": "2023-07-06 21:02:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48410", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 21:02:29 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P48410", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 21:02:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07098", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:02:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07098"}, "ts": "2023-07-06 21:02:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17674202", "type": "PubMed"}, "ts": "2023-07-06 21:02:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17674202", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 21:02:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51174", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:02:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14684736", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 21:03:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14684736", "type": "PubMed"}, "ts": "2023-07-06 21:03:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D8V0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:03:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D8V0"}, "ts": "2023-07-06 21:03:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15056.24.24"}, "ts": "2023-07-06 21:03:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15056", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:03:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A096MK92-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:03:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A096MK92-1"}, "ts": "2023-07-06 21:03:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R697-1"}, "ts": "2023-07-06 21:03:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:03:59 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3f3436b3f77a42879f5eb0a170328500", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:03:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3f3436b3f77a42879f5eb0a170328500", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:03:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R697-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:03:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3f3436b3f77a42879f5eb0a170328500", "user": "Undecided", "type": "error", "page": "glycan-list", "message": "non-existent-search-results error code. list api call"}, "ts": "2023-07-06 21:03:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 21:04:03 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 21:04:03 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 21:04:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:04:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:04:05 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)", "term_category": "any"}, "ts": "2023-07-06 21:04:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:04:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">269b8e3e0e2d48002b2d4a6505934c8a", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:04:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:04:09 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:04:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16828VN"}, "ts": "2023-07-06 21:04:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12398HZ"}, "ts": "2023-07-06 21:04:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65890UA"}, "ts": "2023-07-06 21:04:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69411IG"}, "ts": "2023-07-06 21:04:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07483YN"}, "ts": "2023-07-06 21:04:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14996IQ"}, "ts": "2023-07-06 21:04:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53962WT"}, "ts": "2023-07-06 21:04:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61334IA"}, "ts": "2023-07-06 21:04:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06209KS"}, "ts": "2023-07-06 21:04:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08520NM"}, "ts": "2023-07-06 21:04:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11637WL"}, "ts": "2023-07-06 21:04:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51367TM"}, "ts": "2023-07-06 21:04:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82942ZJ"}, "ts": "2023-07-06 21:04:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37166HP"}, "ts": "2023-07-06 21:04:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35599NO"}, "ts": "2023-07-06 21:04:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33734YD"}, "ts": "2023-07-06 21:04:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84852GW"}, "ts": "2023-07-06 21:04:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04576KS"}, "ts": "2023-07-06 21:04:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44617UT"}, "ts": "2023-07-06 21:04:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97720QM"}, "ts": "2023-07-06 21:04:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:04:15 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:04:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01457KB"}, "ts": "2023-07-06 21:04:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86537AD"}, "ts": "2023-07-06 21:04:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33508VK"}, "ts": "2023-07-06 21:04:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04765GH"}, "ts": "2023-07-06 21:04:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34100DU"}, "ts": "2023-07-06 21:04:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07677VL"}, "ts": "2023-07-06 21:04:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30871VQ"}, "ts": "2023-07-06 21:04:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41424HD"}, "ts": "2023-07-06 21:04:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69500TM"}, "ts": "2023-07-06 21:04:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86186US"}, "ts": "2023-07-06 21:04:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13260JU"}, "ts": "2023-07-06 21:04:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23438NR"}, "ts": "2023-07-06 21:04:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05848DX"}, "ts": "2023-07-06 21:04:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70125XL"}, "ts": "2023-07-06 21:04:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52144RR"}, "ts": "2023-07-06 21:04:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66419SM"}, "ts": "2023-07-06 21:04:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29231AT"}, "ts": "2023-07-06 21:04:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37653KL"}, "ts": "2023-07-06 21:04:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07932PU"}, "ts": "2023-07-06 21:04:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03670RH"}, "ts": "2023-07-06 21:04:17 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:04:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24794ZA"}, "ts": "2023-07-06 21:04:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09912GB"}, "ts": "2023-07-06 21:04:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49844LC"}, "ts": "2023-07-06 21:04:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69631DE"}, "ts": "2023-07-06 21:04:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96079CK"}, "ts": "2023-07-06 21:04:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09343VX"}, "ts": "2023-07-06 21:04:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81303NJ"}, "ts": "2023-07-06 21:04:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59529EG"}, "ts": "2023-07-06 21:04:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80105XT"}, "ts": "2023-07-06 21:04:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01455VM"}, "ts": "2023-07-06 21:04:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92180UW"}, "ts": "2023-07-06 21:04:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77557JA"}, "ts": "2023-07-06 21:04:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13496UJ"}, "ts": "2023-07-06 21:04:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62765JV"}, "ts": "2023-07-06 21:04:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30089VH"}, "ts": "2023-07-06 21:04:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95151JF"}, "ts": "2023-07-06 21:04:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03146JP"}, "ts": "2023-07-06 21:04:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59588WY"}, "ts": "2023-07-06 21:04:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44407SY"}, "ts": "2023-07-06 21:04:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21472XU"}, "ts": "2023-07-06 21:04:20 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:04:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60735SE"}, "ts": "2023-07-06 21:04:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22745SA"}, "ts": "2023-07-06 21:04:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21100PW"}, "ts": "2023-07-06 21:04:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65137ZN"}, "ts": "2023-07-06 21:04:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47947JW"}, "ts": "2023-07-06 21:04:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77152WY"}, "ts": "2023-07-06 21:04:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84641CT"}, "ts": "2023-07-06 21:04:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18892PE"}, "ts": "2023-07-06 21:04:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28134WJ"}, "ts": "2023-07-06 21:04:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88162NH"}, "ts": "2023-07-06 21:04:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66244VX"}, "ts": "2023-07-06 21:04:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51984GX"}, "ts": "2023-07-06 21:04:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29432PD"}, "ts": "2023-07-06 21:04:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20174EZ"}, "ts": "2023-07-06 21:04:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35689CT"}, "ts": "2023-07-06 21:04:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58314JG"}, "ts": "2023-07-06 21:04:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00038MO"}, "ts": "2023-07-06 21:04:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40740AD"}, "ts": "2023-07-06 21:04:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60275BG"}, "ts": "2023-07-06 21:04:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92378XH"}, "ts": "2023-07-06 21:04:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20516077", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 21:04:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20516077", "type": "PubMed"}, "ts": "2023-07-06 21:04:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60735SE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:04:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G60735SE"}, "ts": "2023-07-06 21:04:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LUF8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:04:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LUF8"}, "ts": "2023-07-06 21:04:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60735SE", "user": "Undecided", "type": "user", "page": "glycan", "message": "Performing Direct Search"}, "ts": "2023-07-06 21:04:55 EDT-0400"}, {"api": "/glycan/search/", "req": {"composition": [{"residue": "hexnac", "min": 3, "max": 3}]}, "ts": "2023-07-06 21:04:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60735SE>e99af4c72a900932f10b424ecaffb829", "user": "Undecided", "type": "user", "page": "glycan", "message": "Direct Search query={\"composition\":[{\"residue\":\"hexnac\",\"min\":3,\"max\":3}]}"}, "ts": "2023-07-06 21:05:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "e99af4c72a900932f10b424ecaffb829", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:05:03 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "e99af4c72a900932f10b424ecaffb829", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:05:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61833XV"}, "ts": "2023-07-06 21:05:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00037MO"}, "ts": "2023-07-06 21:05:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19369OY"}, "ts": "2023-07-06 21:05:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86499WY"}, "ts": "2023-07-06 21:05:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27119CB"}, "ts": "2023-07-06 21:05:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83009HN"}, "ts": "2023-07-06 21:05:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66713JJ"}, "ts": "2023-07-06 21:05:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14625"}, "ts": "2023-07-06 21:05:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G51984GX"}, "ts": "2023-07-06 21:05:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G51984GX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:05:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33966114", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 21:05:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33966114", "type": "PubMed"}, "ts": "2023-07-06 21:05:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11532", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:05:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13688-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:06:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13688-1"}, "ts": "2023-07-06 21:06:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 21:06:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "22952603"}, "ts": "2023-07-06 21:06:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 21:06:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "e99af4c72a900932f10b424ecaffb829", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:06:42 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "e99af4c72a900932f10b424ecaffb829", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:06:42 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 21:06:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 21:06:48 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 21:06:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:06:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:06:49 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(1)Hex(1)NeuGc(1)", "term_category": "any"}, "ts": "2023-07-06 21:06:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:06:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">ab570aa087901902f1956cf96228a4e9", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(1)Hex(1)NeuGc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:06:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ab570aa087901902f1956cf96228a4e9", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:06:52 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "ab570aa087901902f1956cf96228a4e9", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:06:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86221TG"}, "ts": "2023-07-06 21:06:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17236TT"}, "ts": "2023-07-06 21:06:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15714MJ"}, "ts": "2023-07-06 21:06:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27945LI"}, "ts": "2023-07-06 21:06:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47967RK"}, "ts": "2023-07-06 21:06:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00647RA"}, "ts": "2023-07-06 21:06:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79574FL"}, "ts": "2023-07-06 21:06:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54426UX"}, "ts": "2023-07-06 21:06:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44900DK"}, "ts": "2023-07-06 21:06:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47701VN"}, "ts": "2023-07-06 21:06:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02070ZG"}, "ts": "2023-07-06 21:06:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25870FA"}, "ts": "2023-07-06 21:06:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04760HF"}, "ts": "2023-07-06 21:06:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29530DJ"}, "ts": "2023-07-06 21:06:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39369QQ"}, "ts": "2023-07-06 21:06:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55192YV"}, "ts": "2023-07-06 21:06:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90077BJ"}, "ts": "2023-07-06 21:06:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94138KN"}, "ts": "2023-07-06 21:06:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82110XO"}, "ts": "2023-07-06 21:06:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90351WW"}, "ts": "2023-07-06 21:06:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17236TT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:07:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17236TT"}, "ts": "2023-07-06 21:07:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32118LZ"}, "ts": "2023-07-06 21:07:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69538RU"}, "ts": "2023-07-06 21:07:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09586"}, "ts": "2023-07-06 21:07:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09586", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:07:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q61739.927.927"}, "ts": "2023-07-06 21:07:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61739", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:07:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ab570aa087901902f1956cf96228a4e9", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:08:10 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "ab570aa087901902f1956cf96228a4e9", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:08:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y487"}, "ts": "2023-07-06 21:08:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y487", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:08:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G54426UX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:08:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G54426UX"}, "ts": "2023-07-06 21:08:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:08:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43508", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:08:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43508"}, "ts": "2023-07-06 21:08:26 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "ab570aa087901902f1956cf96228a4e9", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:08:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ab570aa087901902f1956cf96228a4e9", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:08:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15031"}, "ts": "2023-07-06 21:08:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 21:08:33 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 21:08:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:08:34 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 21:08:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:08:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:08:37 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)Fuc(1)", "term_category": "any"}, "ts": "2023-07-06 21:08:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)Fuc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:08:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:08:43 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)Fuc(1)", "term_category": "any"}, "ts": "2023-07-06 21:08:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)Fuc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:08:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZYY8-1"}, "ts": "2023-07-06 21:08:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6X9"}, "ts": "2023-07-06 21:09:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6X9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:09:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZYY8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:09:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJQ4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:09:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJQ4"}, "ts": "2023-07-06 21:09:06 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G21112ZO"}, "ts": "2023-07-06 21:09:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G21112ZO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:09:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:09:15 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)Fuc(1)", "term_category": "glycan"}, "ts": "2023-07-06 21:09:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)Fuc(1)\",\"term_category\":\"glycan\"}"}, "ts": "2023-07-06 21:09:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06731-1"}, "ts": "2023-07-06 21:09:18 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)", "term_category": "glycan"}, "ts": "2023-07-06 21:09:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:09:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">d3205ed3ab78acad9634f61068c6b30c", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)\",\"term_category\":\"glycan\"}"}, "ts": "2023-07-06 21:09:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "d3205ed3ab78acad9634f61068c6b30c", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:09:24 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "d3205ed3ab78acad9634f61068c6b30c", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:09:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "d3205ed3ab78acad9634f61068c6b30c", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:09:28 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "d3205ed3ab78acad9634f61068c6b30c", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:09:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13598.53.53"}, "ts": "2023-07-06 21:09:33 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "d3205ed3ab78acad9634f61068c6b30c", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:09:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13598", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:09:34 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "d3205ed3ab78acad9634f61068c6b30c", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:09:37 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "d3205ed3ab78acad9634f61068c6b30c", "offset": 21, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:09:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52227EX"}, "ts": "2023-07-06 21:09:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15813JZ"}, "ts": "2023-07-06 21:09:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28755KN"}, "ts": "2023-07-06 21:09:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08735WG"}, "ts": "2023-07-06 21:09:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75032PM"}, "ts": "2023-07-06 21:09:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68893BQ"}, "ts": "2023-07-06 21:09:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79003DV"}, "ts": "2023-07-06 21:09:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57808QW"}, "ts": "2023-07-06 21:09:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29549OQ"}, "ts": "2023-07-06 21:09:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69003EQ"}, "ts": "2023-07-06 21:09:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67697EV"}, "ts": "2023-07-06 21:09:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71990XF"}, "ts": "2023-07-06 21:09:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65460ES"}, "ts": "2023-07-06 21:09:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57998VW"}, "ts": "2023-07-06 21:09:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34632KL"}, "ts": "2023-07-06 21:09:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66040GE"}, "ts": "2023-07-06 21:09:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20151DP"}, "ts": "2023-07-06 21:09:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04203ZT"}, "ts": "2023-07-06 21:09:49 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "d3205ed3ab78acad9634f61068c6b30c", "offset": 61, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:09:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21246WW"}, "ts": "2023-07-06 21:09:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94180RN"}, "ts": "2023-07-06 21:09:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46304CE"}, "ts": "2023-07-06 21:09:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76703CC"}, "ts": "2023-07-06 21:09:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22412KQ"}, "ts": "2023-07-06 21:09:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83997EZ"}, "ts": "2023-07-06 21:09:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85313YF"}, "ts": "2023-07-06 21:09:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45333UL"}, "ts": "2023-07-06 21:09:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37657QO"}, "ts": "2023-07-06 21:09:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13824WQ"}, "ts": "2023-07-06 21:09:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87280CM"}, "ts": "2023-07-06 21:09:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88815IR"}, "ts": "2023-07-06 21:09:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48809BS"}, "ts": "2023-07-06 21:09:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87103TP"}, "ts": "2023-07-06 21:09:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29031ZI"}, "ts": "2023-07-06 21:09:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86389LM"}, "ts": "2023-07-06 21:09:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77938WM"}, "ts": "2023-07-06 21:09:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17740TV"}, "ts": "2023-07-06 21:09:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41227ZE"}, "ts": "2023-07-06 21:09:59 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "d3205ed3ab78acad9634f61068c6b30c", "offset": 41, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:10:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56913CG"}, "ts": "2023-07-06 21:10:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16214HG"}, "ts": "2023-07-06 21:10:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74804ZA"}, "ts": "2023-07-06 21:10:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71743JP"}, "ts": "2023-07-06 21:10:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07898UR"}, "ts": "2023-07-06 21:10:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46681XX"}, "ts": "2023-07-06 21:10:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14870EV"}, "ts": "2023-07-06 21:10:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09980KC"}, "ts": "2023-07-06 21:10:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53206FD"}, "ts": "2023-07-06 21:10:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98753FD"}, "ts": "2023-07-06 21:10:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47520QY"}, "ts": "2023-07-06 21:10:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10023KT"}, "ts": "2023-07-06 21:10:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74491LU"}, "ts": "2023-07-06 21:10:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85887XT"}, "ts": "2023-07-06 21:10:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05405HZ"}, "ts": "2023-07-06 21:10:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07395MI"}, "ts": "2023-07-06 21:10:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67998OP"}, "ts": "2023-07-06 21:10:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23501RV"}, "ts": "2023-07-06 21:10:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67212WQ"}, "ts": "2023-07-06 21:10:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38799GI"}, "ts": "2023-07-06 21:10:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JXA5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:10:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JXA5-1"}, "ts": "2023-07-06 21:10:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:10:30 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 21:10:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:10:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:10:33 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(1)Hex(1)Fuc(1)NeuGc(1)", "term_category": "any"}, "ts": "2023-07-06 21:10:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(1)Hex(1)Fuc(1)NeuGc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:10:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:10:55 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(1)Hex(1)dHex(1)NeuGc(1)", "term_category": "any"}, "ts": "2023-07-06 21:10:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JHY2-1"}, "ts": "2023-07-06 21:10:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JHY2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:11:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">e1a917fbb509423691e8ee8f6a82a9a8", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(1)Hex(1)dHex(1)NeuGc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:11:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZLE0-1"}, "ts": "2023-07-06 21:11:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZLE0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:11:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "e1a917fbb509423691e8ee8f6a82a9a8", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:11:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35663"}, "ts": "2023-07-06 21:11:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08590"}, "ts": "2023-07-06 21:11:08 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "e1a917fbb509423691e8ee8f6a82a9a8", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:11:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 21:11:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17496PY"}, "ts": "2023-07-06 21:11:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14597715", "type": "PubMed"}, "ts": "2023-07-06 21:11:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08053IV"}, "ts": "2023-07-06 21:11:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02804WX"}, "ts": "2023-07-06 21:11:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14597715", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 21:11:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16691WC"}, "ts": "2023-07-06 21:11:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14876IZ"}, "ts": "2023-07-06 21:11:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75699GA"}, "ts": "2023-07-06 21:11:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47976ZQ"}, "ts": "2023-07-06 21:11:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68910MO"}, "ts": "2023-07-06 21:11:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56608NS"}, "ts": "2023-07-06 21:11:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06149HH"}, "ts": "2023-07-06 21:11:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92174WX"}, "ts": "2023-07-06 21:11:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86811CV"}, "ts": "2023-07-06 21:11:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44745DH"}, "ts": "2023-07-06 21:11:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60955JE"}, "ts": "2023-07-06 21:11:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27745TR"}, "ts": "2023-07-06 21:11:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36823XT"}, "ts": "2023-07-06 21:11:16 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "e1a917fbb509423691e8ee8f6a82a9a8", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:11:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q49A26", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:11:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q49A26.419.419"}, "ts": "2023-07-06 21:11:24 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "e1a917fbb509423691e8ee8f6a82a9a8", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": []}, "ts": "2023-07-06 21:11:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88909", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 21:11:58 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O88909", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 21:11:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88909", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 21:11:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:12:03 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 21:12:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4VCS5"}, "ts": "2023-07-06 21:12:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4VCS5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:12:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:12:43 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(1)HexNAc(1)dHex(1)NeuGc(1)", "term_category": "any"}, "ts": "2023-07-06 21:12:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">25dfb76097c09a8dfecdf865f6b20577", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(1)HexNAc(1)dHex(1)NeuGc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:12:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25dfb76097c09a8dfecdf865f6b20577", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:12:44 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "25dfb76097c09a8dfecdf865f6b20577", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:12:44 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "25dfb76097c09a8dfecdf865f6b20577", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:12:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19275885", "type": "PubMed"}, "ts": "2023-07-06 21:12:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19275885", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 21:12:50 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "25dfb76097c09a8dfecdf865f6b20577", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": []}, "ts": "2023-07-06 21:12:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14679", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:12:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14679"}, "ts": "2023-07-06 21:12:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CQE7"}, "ts": "2023-07-06 21:13:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CQE7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:13:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 21:13:07 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 21:13:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:13:07 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 21:13:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:13:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06210XB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:13:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06210XB"}, "ts": "2023-07-06 21:13:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:13:26 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(1)HexNAc(1)dHex(1)NeuGc(1)", "term_category": "any"}, "ts": "2023-07-06 21:13:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">25dfb76097c09a8dfecdf865f6b20577", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(1)HexNAc(1)dHex(1)NeuGc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:13:27 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "25dfb76097c09a8dfecdf865f6b20577", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:13:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25dfb76097c09a8dfecdf865f6b20577", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:13:27 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "25dfb76097c09a8dfecdf865f6b20577", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:13:47 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "25dfb76097c09a8dfecdf865f6b20577", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": []}, "ts": "2023-07-06 21:13:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RAB0-1"}, "ts": "2023-07-06 21:13:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RAB0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:14:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:14:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N127"}, "ts": "2023-07-06 21:14:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N127", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:14:07 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 21:14:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 21:14:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 21:14:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:14:19 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 21:14:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9Q1T6"}, "ts": "2023-07-06 21:14:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q1T6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 21:14:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "license", "message": "page access"}, "ts": "2023-07-06 21:14:26 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)dHex(1)", "term_category": "any"}, "ts": "2023-07-06 21:14:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:14:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">4feafeecdd4e72d764d3e4794392c8f9", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)dHex(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:14:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4feafeecdd4e72d764d3e4794392c8f9", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:14:27 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "4feafeecdd4e72d764d3e4794392c8f9", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:14:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04744XB"}, "ts": "2023-07-06 21:14:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66129DI"}, "ts": "2023-07-06 21:14:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48954CA"}, "ts": "2023-07-06 21:14:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10300DY"}, "ts": "2023-07-06 21:14:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83258AP"}, "ts": "2023-07-06 21:14:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45889JQ"}, "ts": "2023-07-06 21:14:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11994QC"}, "ts": "2023-07-06 21:14:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62389NM"}, "ts": "2023-07-06 21:14:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45036WQ"}, "ts": "2023-07-06 21:14:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30439IP"}, "ts": "2023-07-06 21:14:29 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "4feafeecdd4e72d764d3e4794392c8f9", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:14:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83676GD"}, "ts": "2023-07-06 21:14:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40480ZI"}, "ts": "2023-07-06 21:14:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55444WK"}, "ts": "2023-07-06 21:14:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54992WG"}, "ts": "2023-07-06 21:14:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18359FA"}, "ts": "2023-07-06 21:14:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54620LW"}, "ts": "2023-07-06 21:14:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50474QL"}, "ts": "2023-07-06 21:14:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58736XQ"}, "ts": "2023-07-06 21:14:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52986VZ"}, "ts": "2023-07-06 21:14:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57422AW"}, "ts": "2023-07-06 21:14:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92527PR"}, "ts": "2023-07-06 21:14:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53232TN"}, "ts": "2023-07-06 21:14:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19898UW"}, "ts": "2023-07-06 21:14:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83466CO"}, "ts": "2023-07-06 21:14:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05242GV"}, "ts": "2023-07-06 21:14:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44305KR"}, "ts": "2023-07-06 21:14:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49020UX"}, "ts": "2023-07-06 21:14:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48756XC"}, "ts": "2023-07-06 21:14:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42713IF"}, "ts": "2023-07-06 21:14:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18181XX"}, "ts": "2023-07-06 21:14:33 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "4feafeecdd4e72d764d3e4794392c8f9", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": []}, "ts": "2023-07-06 21:14:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02563ZC"}, "ts": "2023-07-06 21:14:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96066HD"}, "ts": "2023-07-06 21:14:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22787WJ"}, "ts": "2023-07-06 21:14:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07858AR"}, "ts": "2023-07-06 21:14:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51080VE"}, "ts": "2023-07-06 21:14:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88143XD"}, "ts": "2023-07-06 21:14:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22564NT"}, "ts": "2023-07-06 21:14:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10687EF"}, "ts": "2023-07-06 21:14:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78429YP"}, "ts": "2023-07-06 21:14:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43252PG"}, "ts": "2023-07-06 21:14:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29970QU"}, "ts": "2023-07-06 21:14:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81126MU"}, "ts": "2023-07-06 21:14:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17631NW"}, "ts": "2023-07-06 21:14:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77208XM"}, "ts": "2023-07-06 21:14:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44139ZU"}, "ts": "2023-07-06 21:14:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02370LQ"}, "ts": "2023-07-06 21:14:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74242PX"}, "ts": "2023-07-06 21:14:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02305XD"}, "ts": "2023-07-06 21:14:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14125ZW"}, "ts": "2023-07-06 21:14:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4feafeecdd4e72d764d3e4794392c8f9", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:15:05 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "4feafeecdd4e72d764d3e4794392c8f9", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:15:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88908BO"}, "ts": "2023-07-06 21:15:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32652KI"}, "ts": "2023-07-06 21:15:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26724PP"}, "ts": "2023-07-06 21:15:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74038AG"}, "ts": "2023-07-06 21:15:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70528XB"}, "ts": "2023-07-06 21:15:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04908IA"}, "ts": "2023-07-06 21:15:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82698QQ"}, "ts": "2023-07-06 21:15:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53435KM"}, "ts": "2023-07-06 21:15:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80690PN"}, "ts": "2023-07-06 21:15:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96416NB"}, "ts": "2023-07-06 21:15:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04114CX"}, "ts": "2023-07-06 21:15:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60067UC"}, "ts": "2023-07-06 21:15:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54896JZ"}, "ts": "2023-07-06 21:15:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25538MM"}, "ts": "2023-07-06 21:15:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39523KI"}, "ts": "2023-07-06 21:15:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70783BY"}, "ts": "2023-07-06 21:15:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15021LG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:15:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZH0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:15:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZH0"}, "ts": "2023-07-06 21:15:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01127"}, "ts": "2023-07-06 21:15:33 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "4feafeecdd4e72d764d3e4794392c8f9", "offset": 21, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:15:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40291QP"}, "ts": "2023-07-06 21:15:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11846US"}, "ts": "2023-07-06 21:15:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42226"}, "ts": "2023-07-06 21:15:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12610QL"}, "ts": "2023-07-06 21:15:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51665JN"}, "ts": "2023-07-06 21:15:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46525FF"}, "ts": "2023-07-06 21:15:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86917QS"}, "ts": "2023-07-06 21:15:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75381CL"}, "ts": "2023-07-06 21:15:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09321GU"}, "ts": "2023-07-06 21:15:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21259PI"}, "ts": "2023-07-06 21:15:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48558NN"}, "ts": "2023-07-06 21:15:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20352TS"}, "ts": "2023-07-06 21:15:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14693JJ"}, "ts": "2023-07-06 21:15:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23392LW"}, "ts": "2023-07-06 21:15:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23491CM"}, "ts": "2023-07-06 21:15:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51963NX"}, "ts": "2023-07-06 21:15:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88599FO"}, "ts": "2023-07-06 21:15:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82970CD"}, "ts": "2023-07-06 21:15:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26021BY"}, "ts": "2023-07-06 21:15:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78918BK"}, "ts": "2023-07-06 21:15:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:15:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60779", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:15:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60779"}, "ts": "2023-07-06 21:15:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:16:09 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 21:16:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16070", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:16:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16070"}, "ts": "2023-07-06 21:16:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:16:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12904"}, "ts": "2023-07-06 21:16:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12904", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 21:16:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-06 21:16:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06330RB"}, "ts": "2023-07-06 21:16:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02030ZB"}, "ts": "2023-07-06 21:16:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-06 21:16:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13694XX"}, "ts": "2023-07-06 21:16:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-06 21:16:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15169WU"}, "ts": "2023-07-06 21:16:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20312EM"}, "ts": "2023-07-06 21:16:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-06 21:16:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23010ZW"}, "ts": "2023-07-06 21:16:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25418HZ"}, "ts": "2023-07-06 21:16:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25451PN"}, "ts": "2023-07-06 21:16:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33791AF"}, "ts": "2023-07-06 21:16:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37881RL"}, "ts": "2023-07-06 21:16:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39595FH"}, "ts": "2023-07-06 21:16:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44215PV"}, "ts": "2023-07-06 21:16:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46524LG"}, "ts": "2023-07-06 21:16:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47012YE"}, "ts": "2023-07-06 21:16:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47518TP"}, "ts": "2023-07-06 21:16:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-06 21:16:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53434XO"}, "ts": "2023-07-06 21:16:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-06 21:16:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61916", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 21:16:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61916"}, "ts": "2023-07-06 21:16:24 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(1)HexNAc(2)NeuGc(1)", "term_category": "any"}, "ts": "2023-07-06 21:16:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:16:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">60eab623f7aac65f7f14021b4f7120a9", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(1)HexNAc(2)NeuGc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:16:27 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "60eab623f7aac65f7f14021b4f7120a9", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:16:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "60eab623f7aac65f7f14021b4f7120a9", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:16:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10013HB"}, "ts": "2023-07-06 21:16:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74699ZT"}, "ts": "2023-07-06 21:16:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06116KH"}, "ts": "2023-07-06 21:16:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31676DD"}, "ts": "2023-07-06 21:16:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28010TC"}, "ts": "2023-07-06 21:16:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51914HP"}, "ts": "2023-07-06 21:16:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36511AX"}, "ts": "2023-07-06 21:16:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41203GX"}, "ts": "2023-07-06 21:16:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86118SN"}, "ts": "2023-07-06 21:16:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88850TN"}, "ts": "2023-07-06 21:16:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77211VC"}, "ts": "2023-07-06 21:16:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06090HW"}, "ts": "2023-07-06 21:16:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28481VT"}, "ts": "2023-07-06 21:16:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63519GO"}, "ts": "2023-07-06 21:16:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30774XC"}, "ts": "2023-07-06 21:16:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22491WZ"}, "ts": "2023-07-06 21:16:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37844TL"}, "ts": "2023-07-06 21:16:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46053AE"}, "ts": "2023-07-06 21:16:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06566UK"}, "ts": "2023-07-06 21:16:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70245EB"}, "ts": "2023-07-06 21:16:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G10013HB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:16:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10013HB"}, "ts": "2023-07-06 21:16:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67965XD"}, "ts": "2023-07-06 21:16:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57236QQ"}, "ts": "2023-07-06 21:16:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K4D9-1"}, "ts": "2023-07-06 21:16:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K4D9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:16:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60237", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:17:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59648", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 21:17:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59648"}, "ts": "2023-07-06 21:17:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00338", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:18:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00338.108.108"}, "ts": "2023-07-06 21:18:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G63519GO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:18:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G63519GO"}, "ts": "2023-07-06 21:18:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29320-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 21:18:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29320-1"}, "ts": "2023-07-06 21:18:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-06 21:18:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62386"}, "ts": "2023-07-06 21:19:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96L42.787.787"}, "ts": "2023-07-06 21:19:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L42", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:19:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G10013HB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:19:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10013HB"}, "ts": "2023-07-06 21:19:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NUL3"}, "ts": "2023-07-06 21:19:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUL3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:19:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z0Y7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 21:19:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z0Y7"}, "ts": "2023-07-06 21:19:54 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 21:19:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 21:19:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:19:57 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 21:19:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:19:57 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(1)HexNAc(1)NeuAc(1)NeuGc(1)", "term_category": "any"}, "ts": "2023-07-06 21:20:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:20:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">aa4dc42a6beada71163166e1c45b6498", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(1)HexNAc(1)NeuAc(1)NeuGc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:20:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "aa4dc42a6beada71163166e1c45b6498", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:20:10 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "aa4dc42a6beada71163166e1c45b6498", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:20:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10436HD"}, "ts": "2023-07-06 21:20:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15985WB"}, "ts": "2023-07-06 21:20:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29394YZ"}, "ts": "2023-07-06 21:20:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60941UG"}, "ts": "2023-07-06 21:20:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40860PW"}, "ts": "2023-07-06 21:20:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72150EN"}, "ts": "2023-07-06 21:20:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85550KY"}, "ts": "2023-07-06 21:20:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56199RI"}, "ts": "2023-07-06 21:20:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76100HQ"}, "ts": "2023-07-06 21:20:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62146JX"}, "ts": "2023-07-06 21:20:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49527BY"}, "ts": "2023-07-06 21:20:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20482JP"}, "ts": "2023-07-06 21:20:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26651YZ"}, "ts": "2023-07-06 21:20:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G39369QQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:20:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZB51", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:20:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G39369QQ"}, "ts": "2023-07-06 21:20:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "D3ZB51.783.783"}, "ts": "2023-07-06 21:20:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67942WV"}, "ts": "2023-07-06 21:20:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14625", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:21:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZL4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:21:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZL4"}, "ts": "2023-07-06 21:21:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWL2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:21:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:21:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IWL2.160.160"}, "ts": "2023-07-06 21:21:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91X79", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:21:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91X79"}, "ts": "2023-07-06 21:21:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13727", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:21:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13727.23.23"}, "ts": "2023-07-06 21:21:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NH11", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:21:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NH11"}, "ts": "2023-07-06 21:21:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N148", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:21:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N148"}, "ts": "2023-07-06 21:21:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R1S7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:22:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R1S7"}, "ts": "2023-07-06 21:22:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G55226UG"}, "ts": "2023-07-06 21:22:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G55226UG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:22:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:23:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TD46", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:23:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TD46"}, "ts": "2023-07-06 21:23:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 21:23:40 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 21:23:40 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 21:23:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:23:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:23:41 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(1)HexNAc(4)", "term_category": "any"}, "ts": "2023-07-06 21:23:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:23:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">ff8a25aaea3e37fa7590314abcdad915", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(1)HexNAc(4)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:23:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ff8a25aaea3e37fa7590314abcdad915", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:23:48 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "ff8a25aaea3e37fa7590314abcdad915", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:23:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78059CC"}, "ts": "2023-07-06 21:23:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56749GV"}, "ts": "2023-07-06 21:23:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80858MF"}, "ts": "2023-07-06 21:23:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11041DA"}, "ts": "2023-07-06 21:23:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 21:23:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45495MK"}, "ts": "2023-07-06 21:23:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08146BT"}, "ts": "2023-07-06 21:23:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57818FI"}, "ts": "2023-07-06 21:23:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53752TA"}, "ts": "2023-07-06 21:23:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96921ZU"}, "ts": "2023-07-06 21:23:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27919IH"}, "ts": "2023-07-06 21:23:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58667NI"}, "ts": "2023-07-06 21:23:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30460NZ"}, "ts": "2023-07-06 21:23:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43694RQ"}, "ts": "2023-07-06 21:23:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07392QY"}, "ts": "2023-07-06 21:23:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23295TF"}, "ts": "2023-07-06 21:23:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86750HK"}, "ts": "2023-07-06 21:23:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82680EC"}, "ts": "2023-07-06 21:23:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59655SA"}, "ts": "2023-07-06 21:23:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52428MJ"}, "ts": "2023-07-06 21:23:51 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "ff8a25aaea3e37fa7590314abcdad915", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:23:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60973ZJ"}, "ts": "2023-07-06 21:23:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20400NO"}, "ts": "2023-07-06 21:23:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19385TO"}, "ts": "2023-07-06 21:23:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06045JZ"}, "ts": "2023-07-06 21:23:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96384IY"}, "ts": "2023-07-06 21:23:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69124GG"}, "ts": "2023-07-06 21:23:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76599PL"}, "ts": "2023-07-06 21:23:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17389EH"}, "ts": "2023-07-06 21:23:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72951AH"}, "ts": "2023-07-06 21:23:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50518XT"}, "ts": "2023-07-06 21:23:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13492FY"}, "ts": "2023-07-06 21:23:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03948VT"}, "ts": "2023-07-06 21:23:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76285RN"}, "ts": "2023-07-06 21:23:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35407XS"}, "ts": "2023-07-06 21:23:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90445GN"}, "ts": "2023-07-06 21:23:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60929YB"}, "ts": "2023-07-06 21:23:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03393XG"}, "ts": "2023-07-06 21:23:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91387VV"}, "ts": "2023-07-06 21:23:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68513DO"}, "ts": "2023-07-06 21:23:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47164CZ"}, "ts": "2023-07-06 21:23:55 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "ff8a25aaea3e37fa7590314abcdad915", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": []}, "ts": "2023-07-06 21:23:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59229NY"}, "ts": "2023-07-06 21:23:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98229OL"}, "ts": "2023-07-06 21:23:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09812PB"}, "ts": "2023-07-06 21:23:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05189AI"}, "ts": "2023-07-06 21:23:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68667ZV"}, "ts": "2023-07-06 21:23:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30190ML"}, "ts": "2023-07-06 21:23:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85039TI"}, "ts": "2023-07-06 21:23:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38428OL"}, "ts": "2023-07-06 21:23:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40778XV"}, "ts": "2023-07-06 21:23:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11937GI"}, "ts": "2023-07-06 21:23:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98940EW"}, "ts": "2023-07-06 21:23:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78792AJ"}, "ts": "2023-07-06 21:23:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94824OK"}, "ts": "2023-07-06 21:23:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12047XR"}, "ts": "2023-07-06 21:23:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31429WT"}, "ts": "2023-07-06 21:23:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19883IH"}, "ts": "2023-07-06 21:23:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43572AH"}, "ts": "2023-07-06 21:23:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15307GJ"}, "ts": "2023-07-06 21:23:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85243CH"}, "ts": "2023-07-06 21:23:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56221OY"}, "ts": "2023-07-06 21:23:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZVQ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:24:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZVQ1"}, "ts": "2023-07-06 21:24:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78345", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:24:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78345"}, "ts": "2023-07-06 21:24:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G59229NY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:24:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G59229NY"}, "ts": "2023-07-06 21:24:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000016"}, "ts": "2023-07-06 21:24:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JWF2"}, "ts": "2023-07-06 21:24:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JWF2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:24:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35363"}, "ts": "2023-07-06 21:24:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01453", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:25:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01453"}, "ts": "2023-07-06 21:25:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20081858", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 21:25:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20081858", "type": "PubMed"}, "ts": "2023-07-06 21:25:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TAF3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:25:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TAF3.226.226"}, "ts": "2023-07-06 21:25:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29315-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-06 21:26:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P26717.100.100"}, "ts": "2023-07-06 21:26:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26717", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:26:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2E5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:26:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P2E5.92.92"}, "ts": "2023-07-06 21:26:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55083", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:26:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55083.87.87"}, "ts": "2023-07-06 21:26:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G58399HX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:26:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58399HX"}, "ts": "2023-07-06 21:26:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96KR1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:26:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96KR1.423.423"}, "ts": "2023-07-06 21:26:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:26:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16186", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:26:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16186"}, "ts": "2023-07-06 21:26:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35663", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:27:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21554-1"}, "ts": "2023-07-06 21:27:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21554-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 21:27:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08590", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:27:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 21:27:09 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 21:27:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:27:09 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 21:27:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:27:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:27:12 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(1)Hex(1)NeuGc(2)", "term_category": "any"}, "ts": "2023-07-06 21:27:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">62e1b36a4d38bcb2b192b57468adb1bb", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(1)Hex(1)NeuGc(2)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:27:13 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "62e1b36a4d38bcb2b192b57468adb1bb", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:27:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "62e1b36a4d38bcb2b192b57468adb1bb", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:27:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02752WS"}, "ts": "2023-07-06 21:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85079IJ"}, "ts": "2023-07-06 21:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25757VY"}, "ts": "2023-07-06 21:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46108TZ"}, "ts": "2023-07-06 21:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74827ZJ"}, "ts": "2023-07-06 21:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28378DY"}, "ts": "2023-07-06 21:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01710XJ"}, "ts": "2023-07-06 21:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76351FY"}, "ts": "2023-07-06 21:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24383AQ"}, "ts": "2023-07-06 21:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74218UV"}, "ts": "2023-07-06 21:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09223MU"}, "ts": "2023-07-06 21:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84822FH"}, "ts": "2023-07-06 21:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34824ZD"}, "ts": "2023-07-06 21:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01657UH"}, "ts": "2023-07-06 21:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67326LW"}, "ts": "2023-07-06 21:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55223IP"}, "ts": "2023-07-06 21:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07937GC"}, "ts": "2023-07-06 21:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26806EA"}, "ts": "2023-07-06 21:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19647KE"}, "ts": "2023-07-06 21:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93365WI"}, "ts": "2023-07-06 21:27:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02752WS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:27:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02752WS"}, "ts": "2023-07-06 21:27:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19185OK"}, "ts": "2023-07-06 21:27:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22705788", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 21:27:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22705788", "type": "PubMed"}, "ts": "2023-07-06 21:27:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UY8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:27:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86UY8.323.323"}, "ts": "2023-07-06 21:27:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96D05"}, "ts": "2023-07-06 21:28:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:28:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96D05", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:28:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4AD59", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:28:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4AD59"}, "ts": "2023-07-06 21:28:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42227"}, "ts": "2023-07-06 21:28:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9242611", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 21:28:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9242611", "type": "PubMed"}, "ts": "2023-07-06 21:28:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13546"}, "ts": "2023-07-06 21:28:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32970"}, "ts": "2023-07-06 21:29:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 21:29:22 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 21:29:22 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 21:29:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:29:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:29:23 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(2)Hex(1)dHex(1)NeuGc(1)", "term_category": "any"}, "ts": "2023-07-06 21:29:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:29:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">da77b4cc91b2992c168b854775d34d34", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(2)Hex(1)dHex(1)NeuGc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:29:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "da77b4cc91b2992c168b854775d34d34", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:29:33 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "da77b4cc91b2992c168b854775d34d34", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:29:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16607BW"}, "ts": "2023-07-06 21:29:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79410LS"}, "ts": "2023-07-06 21:29:34 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "da77b4cc91b2992c168b854775d34d34", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:29:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4ACX7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:29:56 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "da77b4cc91b2992c168b854775d34d34", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": []}, "ts": "2023-07-06 21:29:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4ACX7-1"}, "ts": "2023-07-06 21:29:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68363"}, "ts": "2023-07-06 21:30:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKY1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:30:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UKY1.36.36"}, "ts": "2023-07-06 21:30:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 21:30:30 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 21:30:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60900", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:30:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60900"}, "ts": "2023-07-06 21:30:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RAN9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:30:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RAN9"}, "ts": "2023-07-06 21:30:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:30:45 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 21:30:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:30:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:30:51 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(1)HexNAc(2)dHex(1)NeuGc(1)", "term_category": "any"}, "ts": "2023-07-06 21:30:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">1a7b96c3ffefca332493d171cdbf2810", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(1)HexNAc(2)dHex(1)NeuGc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:30:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1a7b96c3ffefca332493d171cdbf2810", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:30:51 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "1a7b96c3ffefca332493d171cdbf2810", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:30:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 21:31:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:31:14 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 21:31:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:31:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:31:18 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)Hex(1)NeuAc(1)", "term_category": "any"}, "ts": "2023-07-06 21:31:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">e14d8a1ff45e575296a3bbe2737452d0", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)Hex(1)NeuAc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:31:19 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "e14d8a1ff45e575296a3bbe2737452d0", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:31:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "e14d8a1ff45e575296a3bbe2737452d0", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:31:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81581UV"}, "ts": "2023-07-06 21:31:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33269XL"}, "ts": "2023-07-06 21:31:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71146MY"}, "ts": "2023-07-06 21:31:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59576IJ"}, "ts": "2023-07-06 21:31:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46759WS"}, "ts": "2023-07-06 21:31:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12511VU"}, "ts": "2023-07-06 21:31:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37442IW"}, "ts": "2023-07-06 21:31:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46387UV"}, "ts": "2023-07-06 21:31:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79810PX"}, "ts": "2023-07-06 21:31:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85121UD"}, "ts": "2023-07-06 21:31:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30109UP"}, "ts": "2023-07-06 21:31:21 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "e14d8a1ff45e575296a3bbe2737452d0", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:31:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10773YW"}, "ts": "2023-07-06 21:31:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42155ZX"}, "ts": "2023-07-06 21:31:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20951PE"}, "ts": "2023-07-06 21:31:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92061JJ"}, "ts": "2023-07-06 21:31:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77317PB"}, "ts": "2023-07-06 21:31:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09440SH"}, "ts": "2023-07-06 21:31:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61714PI"}, "ts": "2023-07-06 21:31:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21920ZC"}, "ts": "2023-07-06 21:31:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09009DV"}, "ts": "2023-07-06 21:31:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2KHR3-1"}, "ts": "2023-07-06 21:31:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08873KW"}, "ts": "2023-07-06 21:31:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24754HF"}, "ts": "2023-07-06 21:31:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93107BF"}, "ts": "2023-07-06 21:31:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09528DL"}, "ts": "2023-07-06 21:31:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06131JN"}, "ts": "2023-07-06 21:31:29 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "e14d8a1ff45e575296a3bbe2737452d0", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": []}, "ts": "2023-07-06 21:31:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2KHR3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:31:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40995JK"}, "ts": "2023-07-06 21:31:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69897TU"}, "ts": "2023-07-06 21:31:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42958BQ"}, "ts": "2023-07-06 21:31:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30783DZ"}, "ts": "2023-07-06 21:31:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35326EH"}, "ts": "2023-07-06 21:31:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24713JA"}, "ts": "2023-07-06 21:31:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98817QU"}, "ts": "2023-07-06 21:31:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62484VX"}, "ts": "2023-07-06 21:31:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18128PI"}, "ts": "2023-07-06 21:31:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74114HO"}, "ts": "2023-07-06 21:31:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21705OS"}, "ts": "2023-07-06 21:31:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2GUX4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 21:31:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07082VU"}, "ts": "2023-07-06 21:31:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07275AV"}, "ts": "2023-07-06 21:31:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96425TB"}, "ts": "2023-07-06 21:31:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67306YE"}, "ts": "2023-07-06 21:31:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87063TV"}, "ts": "2023-07-06 21:31:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20165PS"}, "ts": "2023-07-06 21:31:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88609PK"}, "ts": "2023-07-06 21:31:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29301RL"}, "ts": "2023-07-06 21:31:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2GUX4"}, "ts": "2023-07-06 21:31:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42226", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:31:36 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G60736DD"}, "ts": "2023-07-06 21:31:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60736DD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:31:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G69897TU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:31:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G69897TU"}, "ts": "2023-07-06 21:31:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000051"}, "ts": "2023-07-06 21:31:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42613QM"}, "ts": "2023-07-06 21:31:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-06 21:31:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16532JG"}, "ts": "2023-07-06 21:31:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000034"}, "ts": "2023-07-06 21:31:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BSY4"}, "ts": "2023-07-06 21:32:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BSY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:32:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:32:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6V0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:32:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6V0"}, "ts": "2023-07-06 21:32:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28288", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:32:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P28288.525.525"}, "ts": "2023-07-06 21:32:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04919"}, "ts": "2023-07-06 21:32:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04919", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:32:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "e14d8a1ff45e575296a3bbe2737452d0", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:32:31 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "e14d8a1ff45e575296a3bbe2737452d0", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:32:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O76036"}, "ts": "2023-07-06 21:32:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76036", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:32:45 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "e14d8a1ff45e575296a3bbe2737452d0", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:32:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5QJU3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:32:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5QJU3"}, "ts": "2023-07-06 21:32:45 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "e14d8a1ff45e575296a3bbe2737452d0", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": []}, "ts": "2023-07-06 21:32:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G40995JK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:32:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G40995JK"}, "ts": "2023-07-06 21:32:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61216", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:33:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61216"}, "ts": "2023-07-06 21:33:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18999ZC"}, "ts": "2023-07-06 21:33:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18999ZC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:33:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2K2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:33:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H2K2.624.624"}, "ts": "2023-07-06 21:33:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UNA4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:34:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16444.332.332"}, "ts": "2023-07-06 21:34:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16444", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:34:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G43417UB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:34:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62386", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:34:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 21:35:00 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 21:35:00 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 21:35:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:35:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:35:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:35:09 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)Hex(1)dHex(2)", "term_category": "any"}, "ts": "2023-07-06 21:35:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">0e7ec07e9dc3b7de96ee3a1d1240d15e", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)Hex(1)dHex(2)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:35:09 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "0e7ec07e9dc3b7de96ee3a1d1240d15e", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:35:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7ec07e9dc3b7de96ee3a1d1240d15e", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:35:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30255XL"}, "ts": "2023-07-06 21:35:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26497EU"}, "ts": "2023-07-06 21:35:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77503IE"}, "ts": "2023-07-06 21:35:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68253RD"}, "ts": "2023-07-06 21:35:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89257WJ"}, "ts": "2023-07-06 21:35:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57840ZW"}, "ts": "2023-07-06 21:35:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39308RS"}, "ts": "2023-07-06 21:35:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89354EL"}, "ts": "2023-07-06 21:35:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86728DD"}, "ts": "2023-07-06 21:35:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13233BL"}, "ts": "2023-07-06 21:35:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55368WO"}, "ts": "2023-07-06 21:35:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16463NX"}, "ts": "2023-07-06 21:35:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93596GX"}, "ts": "2023-07-06 21:35:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02637UJ"}, "ts": "2023-07-06 21:35:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13869XX"}, "ts": "2023-07-06 21:35:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95614HT"}, "ts": "2023-07-06 21:35:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74207QD"}, "ts": "2023-07-06 21:35:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52785CM"}, "ts": "2023-07-06 21:35:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G86186US", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:35:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G86186US"}, "ts": "2023-07-06 21:35:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88775CU"}, "ts": "2023-07-06 21:35:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G67797SG"}, "ts": "2023-07-06 21:35:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G67797SG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:35:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06646VA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:35:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06646VA"}, "ts": "2023-07-06 21:35:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14157"}, "ts": "2023-07-06 21:35:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36222", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:35:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P36222.186.186"}, "ts": "2023-07-06 21:35:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92824", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:36:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92824"}, "ts": "2023-07-06 21:36:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:36:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q1XID0-1"}, "ts": "2023-07-06 21:36:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q1XID0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:36:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K0V6-1"}, "ts": "2023-07-06 21:36:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K0V6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:36:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96RD9.132.132"}, "ts": "2023-07-06 21:36:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RD9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:36:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:37:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N428-1"}, "ts": "2023-07-06 21:37:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N428-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:37:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35186", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:37:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35186"}, "ts": "2023-07-06 21:37:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-06 21:37:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18331357", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 21:37:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18331357", "type": "PubMed"}, "ts": "2023-07-06 21:37:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 21:38:08 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 21:38:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:38:09 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 21:38:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:38:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:38:11 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)Hex(2)Fuc(1)", "term_category": "any"}, "ts": "2023-07-06 21:38:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)Hex(2)Fuc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:38:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:38:22 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)Hex(2)dHex(1)", "term_category": "any"}, "ts": "2023-07-06 21:38:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">4b5ed897932487c77051e40ea457a69e", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)Hex(2)dHex(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:38:23 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "4b5ed897932487c77051e40ea457a69e", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:38:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4b5ed897932487c77051e40ea457a69e", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:38:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39203UC"}, "ts": "2023-07-06 21:38:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89720WL"}, "ts": "2023-07-06 21:38:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77597MJ"}, "ts": "2023-07-06 21:38:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66977DX"}, "ts": "2023-07-06 21:38:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10924UK"}, "ts": "2023-07-06 21:38:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39624YQ"}, "ts": "2023-07-06 21:38:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22626SX"}, "ts": "2023-07-06 21:38:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43639BV"}, "ts": "2023-07-06 21:38:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79600DE"}, "ts": "2023-07-06 21:38:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27893KR"}, "ts": "2023-07-06 21:38:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60687DB"}, "ts": "2023-07-06 21:38:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09698FP"}, "ts": "2023-07-06 21:38:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07646UD"}, "ts": "2023-07-06 21:38:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09441VY"}, "ts": "2023-07-06 21:38:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25955UH"}, "ts": "2023-07-06 21:38:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84596RP"}, "ts": "2023-07-06 21:38:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03340FG"}, "ts": "2023-07-06 21:38:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZVN8-1"}, "ts": "2023-07-06 21:38:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZVN8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:38:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4b5ed897932487c77051e40ea457a69e", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:38:51 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "4b5ed897932487c77051e40ea457a69e", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:38:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90205AB"}, "ts": "2023-07-06 21:38:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G70125XL"}, "ts": "2023-07-06 21:38:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G70125XL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:38:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02809YH"}, "ts": "2023-07-06 21:38:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23960RZ"}, "ts": "2023-07-06 21:38:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54165VC"}, "ts": "2023-07-06 21:38:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17474719", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 21:39:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17474719", "type": "PubMed"}, "ts": "2023-07-06 21:39:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2L6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:40:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2L6"}, "ts": "2023-07-06 21:40:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 21:40:42 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 21:40:42 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 21:40:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:40:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:40:43 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)Hex(3)", "term_category": "any"}, "ts": "2023-07-06 21:40:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:40:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">a763de36e183ec49a6e6ca05d70b81db", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)Hex(3)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:40:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "a763de36e183ec49a6e6ca05d70b81db", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:40:46 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "a763de36e183ec49a6e6ca05d70b81db", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:40:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29905OR"}, "ts": "2023-07-06 21:40:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85041WE"}, "ts": "2023-07-06 21:40:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61751GZ"}, "ts": "2023-07-06 21:40:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35619UY"}, "ts": "2023-07-06 21:40:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64481DJ"}, "ts": "2023-07-06 21:40:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95901MC"}, "ts": "2023-07-06 21:40:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03127AL"}, "ts": "2023-07-06 21:40:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61884GF"}, "ts": "2023-07-06 21:40:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96771UL"}, "ts": "2023-07-06 21:40:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85737WG"}, "ts": "2023-07-06 21:40:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47760VS"}, "ts": "2023-07-06 21:40:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27251WT"}, "ts": "2023-07-06 21:40:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11908FF"}, "ts": "2023-07-06 21:40:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88673AA"}, "ts": "2023-07-06 21:40:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97831CJ"}, "ts": "2023-07-06 21:40:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01600VV"}, "ts": "2023-07-06 21:40:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "a763de36e183ec49a6e6ca05d70b81db", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:40:50 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "a763de36e183ec49a6e6ca05d70b81db", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:40:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65124UZ"}, "ts": "2023-07-06 21:40:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05380VG"}, "ts": "2023-07-06 21:40:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24363HJ"}, "ts": "2023-07-06 21:40:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60734PM"}, "ts": "2023-07-06 21:40:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51827GO"}, "ts": "2023-07-06 21:40:51 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "a763de36e183ec49a6e6ca05d70b81db", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:40:55 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "a763de36e183ec49a6e6ca05d70b81db", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:40:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84532IX"}, "ts": "2023-07-06 21:40:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65756JP"}, "ts": "2023-07-06 21:40:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62469XB"}, "ts": "2023-07-06 21:40:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39205FI"}, "ts": "2023-07-06 21:40:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41387TK"}, "ts": "2023-07-06 21:40:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57949TL"}, "ts": "2023-07-06 21:40:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82264VK"}, "ts": "2023-07-06 21:40:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03016AA"}, "ts": "2023-07-06 21:40:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02725GF"}, "ts": "2023-07-06 21:40:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16503YF"}, "ts": "2023-07-06 21:40:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81213GH"}, "ts": "2023-07-06 21:41:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03825PZ"}, "ts": "2023-07-06 21:41:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31552VX"}, "ts": "2023-07-06 21:41:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02403ZU"}, "ts": "2023-07-06 21:41:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31259RV"}, "ts": "2023-07-06 21:41:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57317CE"}, "ts": "2023-07-06 21:41:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70928KV"}, "ts": "2023-07-06 21:41:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25895SL"}, "ts": "2023-07-06 21:41:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TCG1"}, "ts": "2023-07-06 21:41:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TCG1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:41:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11116090", "type": "PubMed"}, "ts": "2023-07-06 21:41:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11116090", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 21:41:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G82264VK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:41:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G82264VK"}, "ts": "2023-07-06 21:41:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87030LJ"}, "ts": "2023-07-06 21:41:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A6NHZ5.182.182"}, "ts": "2023-07-06 21:41:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NHZ5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:41:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00300", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:41:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00300"}, "ts": "2023-07-06 21:41:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R3M4-1"}, "ts": "2023-07-06 21:42:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R3M4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:42:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99104"}, "ts": "2023-07-06 21:42:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99104", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 21:42:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZBM3"}, "ts": "2023-07-06 21:42:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZBM3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 21:42:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 21:42:58 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 21:42:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:42:58 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 21:42:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:42:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:43:06 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(4)Hex(1)dHex(1)", "term_category": "any"}, "ts": "2023-07-06 21:43:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">b0ba3d7d9f2519ff3d6753dd653eff9b", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(4)Hex(1)dHex(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:43:07 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b0ba3d7d9f2519ff3d6753dd653eff9b", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:43:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b0ba3d7d9f2519ff3d6753dd653eff9b", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:43:08 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b0ba3d7d9f2519ff3d6753dd653eff9b", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:43:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b0ba3d7d9f2519ff3d6753dd653eff9b", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:43:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49277CJ"}, "ts": "2023-07-06 21:43:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71306LD"}, "ts": "2023-07-06 21:43:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29025YS"}, "ts": "2023-07-06 21:43:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30443NG"}, "ts": "2023-07-06 21:43:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26700PN"}, "ts": "2023-07-06 21:43:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49874UX"}, "ts": "2023-07-06 21:43:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46687AB"}, "ts": "2023-07-06 21:43:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14994KB"}, "ts": "2023-07-06 21:43:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54600FO"}, "ts": "2023-07-06 21:43:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25987BV"}, "ts": "2023-07-06 21:43:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59937CP"}, "ts": "2023-07-06 21:43:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38189CI"}, "ts": "2023-07-06 21:43:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59746EH"}, "ts": "2023-07-06 21:43:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33860PM"}, "ts": "2023-07-06 21:43:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87574LM"}, "ts": "2023-07-06 21:43:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25233TU"}, "ts": "2023-07-06 21:43:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83241PZ"}, "ts": "2023-07-06 21:43:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85284LO"}, "ts": "2023-07-06 21:43:14 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b0ba3d7d9f2519ff3d6753dd653eff9b", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:43:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08290VR"}, "ts": "2023-07-06 21:43:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34643KR"}, "ts": "2023-07-06 21:43:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24103VF"}, "ts": "2023-07-06 21:43:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26224UH"}, "ts": "2023-07-06 21:43:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15516RB"}, "ts": "2023-07-06 21:43:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38027UF"}, "ts": "2023-07-06 21:43:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57092PW"}, "ts": "2023-07-06 21:43:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06317RG"}, "ts": "2023-07-06 21:43:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82785ZH"}, "ts": "2023-07-06 21:43:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10532TO"}, "ts": "2023-07-06 21:43:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70976HA"}, "ts": "2023-07-06 21:43:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08316ZV"}, "ts": "2023-07-06 21:43:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52764DM"}, "ts": "2023-07-06 21:43:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55160BC"}, "ts": "2023-07-06 21:43:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91718UR"}, "ts": "2023-07-06 21:43:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05278GV"}, "ts": "2023-07-06 21:43:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46754UT"}, "ts": "2023-07-06 21:43:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85764FQ"}, "ts": "2023-07-06 21:43:18 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b0ba3d7d9f2519ff3d6753dd653eff9b", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:43:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19202DD"}, "ts": "2023-07-06 21:43:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12233LM"}, "ts": "2023-07-06 21:43:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21900DW"}, "ts": "2023-07-06 21:43:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11278756", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 21:43:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11278756", "type": "PubMed"}, "ts": "2023-07-06 21:43:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99999"}, "ts": "2023-07-06 21:43:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99999", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:43:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05189AI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:43:36 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05189AI"}, "ts": "2023-07-06 21:43:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b0ba3d7d9f2519ff3d6753dd653eff9b", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:43:47 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b0ba3d7d9f2519ff3d6753dd653eff9b", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:43:47 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b0ba3d7d9f2519ff3d6753dd653eff9b", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:43:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b0ba3d7d9f2519ff3d6753dd653eff9b", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:43:52 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b0ba3d7d9f2519ff3d6753dd653eff9b", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:43:55 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b0ba3d7d9f2519ff3d6753dd653eff9b", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:43:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25092", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:44:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25092"}, "ts": "2023-07-06 21:44:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2WGJ9"}, "ts": "2023-07-06 21:44:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2WGJ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:44:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G68667ZV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:44:08 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G68667ZV"}, "ts": "2023-07-06 21:44:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PXT9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 21:44:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9PXT9"}, "ts": "2023-07-06 21:44:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CF82", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:44:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CF82"}, "ts": "2023-07-06 21:44:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42227", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:44:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NUJ1"}, "ts": "2023-07-06 21:44:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NUJ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:44:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13546", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:44:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:45:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G71300IN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:45:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G71300IN"}, "ts": "2023-07-06 21:45:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5FVN2"}, "ts": "2023-07-06 21:45:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5FVN2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 21:45:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95229.5.5"}, "ts": "2023-07-06 21:45:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95229", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:45:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99489"}, "ts": "2023-07-06 21:45:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99489", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 21:45:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68363", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:46:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P24046.234.234"}, "ts": "2023-07-06 21:46:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24046", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:46:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 21:46:32 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 21:46:32 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 21:46:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:46:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:46:36 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(4)Hex(2)", "term_category": "any"}, "ts": "2023-07-06 21:46:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:46:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">0b3bccd0608ca12bfe26524321a690ab", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(4)Hex(2)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:46:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0b3bccd0608ca12bfe26524321a690ab", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:46:39 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "0b3bccd0608ca12bfe26524321a690ab", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:46:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90348RI"}, "ts": "2023-07-06 21:46:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07337US"}, "ts": "2023-07-06 21:46:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13156PQ"}, "ts": "2023-07-06 21:46:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86555OF"}, "ts": "2023-07-06 21:46:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87535DG"}, "ts": "2023-07-06 21:46:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76478FT"}, "ts": "2023-07-06 21:46:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79556AB"}, "ts": "2023-07-06 21:46:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43665PB"}, "ts": "2023-07-06 21:46:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75903TQ"}, "ts": "2023-07-06 21:46:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47606XQ"}, "ts": "2023-07-06 21:46:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27293OK"}, "ts": "2023-07-06 21:46:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08242BT"}, "ts": "2023-07-06 21:46:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97459BD"}, "ts": "2023-07-06 21:46:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48975GN"}, "ts": "2023-07-06 21:46:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82252QI"}, "ts": "2023-07-06 21:46:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09635US"}, "ts": "2023-07-06 21:46:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47175EF"}, "ts": "2023-07-06 21:46:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18219CJ"}, "ts": "2023-07-06 21:46:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50106JX"}, "ts": "2023-07-06 21:46:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49299ZV"}, "ts": "2023-07-06 21:46:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0b3bccd0608ca12bfe26524321a690ab", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:46:49 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "0b3bccd0608ca12bfe26524321a690ab", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:46:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61889LW"}, "ts": "2023-07-06 21:46:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73423PD"}, "ts": "2023-07-06 21:46:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13863XN"}, "ts": "2023-07-06 21:46:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34985XL"}, "ts": "2023-07-06 21:46:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74430RZ"}, "ts": "2023-07-06 21:46:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27248RA"}, "ts": "2023-07-06 21:46:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46524LG"}, "ts": "2023-07-06 21:46:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51287LK"}, "ts": "2023-07-06 21:46:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40664HB"}, "ts": "2023-07-06 21:46:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50073PQ"}, "ts": "2023-07-06 21:46:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61855PQ"}, "ts": "2023-07-06 21:46:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29063QY"}, "ts": "2023-07-06 21:46:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34764BK"}, "ts": "2023-07-06 21:46:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77937PE"}, "ts": "2023-07-06 21:46:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08190JB"}, "ts": "2023-07-06 21:46:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25459WN"}, "ts": "2023-07-06 21:46:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27526RV"}, "ts": "2023-07-06 21:46:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01243KR"}, "ts": "2023-07-06 21:46:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G98296DR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:46:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G98296DR"}, "ts": "2023-07-06 21:46:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61889LW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:46:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61889LW"}, "ts": "2023-07-06 21:46:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000002"}, "ts": "2023-07-06 21:47:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64123ZS"}, "ts": "2023-07-06 21:47:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53960NM"}, "ts": "2023-07-06 21:47:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17661"}, "ts": "2023-07-06 21:47:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17661", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:47:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:47:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N614", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:47:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N614.77.77"}, "ts": "2023-07-06 21:47:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G35612AX"}, "ts": "2023-07-06 21:47:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G35612AX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:47:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6QMY6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:47:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6QMY6"}, "ts": "2023-07-06 21:47:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96FW1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:49:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96FW1"}, "ts": "2023-07-06 21:49:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 21:49:21 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 21:49:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:49:21 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 21:49:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:49:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:49:24 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "G29063QY", "term_category": "any"}, "ts": "2023-07-06 21:49:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">a72d15aa10aa2edf20cc7e1705f6393a", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"G29063QY\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:49:24 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "a72d15aa10aa2edf20cc7e1705f6393a", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:49:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "a72d15aa10aa2edf20cc7e1705f6393a", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:49:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724WC"}, "ts": "2023-07-06 21:49:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47925PB"}, "ts": "2023-07-06 21:49:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59432AC"}, "ts": "2023-07-06 21:49:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96643WB"}, "ts": "2023-07-06 21:49:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36807NH"}, "ts": "2023-07-06 21:49:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78930SC"}, "ts": "2023-07-06 21:49:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92389OS"}, "ts": "2023-07-06 21:49:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57183BI"}, "ts": "2023-07-06 21:49:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27642RO"}, "ts": "2023-07-06 21:49:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27469DP"}, "ts": "2023-07-06 21:49:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77628RQ"}, "ts": "2023-07-06 21:49:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92281IL"}, "ts": "2023-07-06 21:49:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31489QJ"}, "ts": "2023-07-06 21:49:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20574XF"}, "ts": "2023-07-06 21:49:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19252DL"}, "ts": "2023-07-06 21:49:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71414DR"}, "ts": "2023-07-06 21:49:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G29063QY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:49:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G29063QY"}, "ts": "2023-07-06 21:49:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09805DP"}, "ts": "2023-07-06 21:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12074QJ"}, "ts": "2023-07-06 21:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13858YJ"}, "ts": "2023-07-06 21:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38697HB"}, "ts": "2023-07-06 21:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53219BI"}, "ts": "2023-07-06 21:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29495CE"}, "ts": "2023-07-06 21:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59371ND"}, "ts": "2023-07-06 21:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59747EH"}, "ts": "2023-07-06 21:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73723ZY"}, "ts": "2023-07-06 21:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80281PU"}, "ts": "2023-07-06 21:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87984PA"}, "ts": "2023-07-06 21:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96334ZO"}, "ts": "2023-07-06 21:49:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12107", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:50:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12107"}, "ts": "2023-07-06 21:50:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 21:50:22 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 21:50:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:50:23 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 21:50:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:50:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:50:25 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(2)Hex(1)NeuAc(2)", "term_category": "any"}, "ts": "2023-07-06 21:50:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">b0469959a9a5ae42ff62dcd16a4719a7", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(2)Hex(1)NeuAc(2)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:50:26 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b0469959a9a5ae42ff62dcd16a4719a7", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:50:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b0469959a9a5ae42ff62dcd16a4719a7", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:50:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y450.154.154"}, "ts": "2023-07-06 21:50:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y450", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:50:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03172PR"}, "ts": "2023-07-06 21:50:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52902AR"}, "ts": "2023-07-06 21:50:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97345NY"}, "ts": "2023-07-06 21:50:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16370GQ"}, "ts": "2023-07-06 21:50:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64712UU"}, "ts": "2023-07-06 21:50:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53208AY"}, "ts": "2023-07-06 21:50:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78315BS"}, "ts": "2023-07-06 21:50:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00063MO"}, "ts": "2023-07-06 21:50:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40737EA"}, "ts": "2023-07-06 21:50:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71121NN"}, "ts": "2023-07-06 21:50:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43220WQ"}, "ts": "2023-07-06 21:50:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85366AQ"}, "ts": "2023-07-06 21:50:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43648PG"}, "ts": "2023-07-06 21:50:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66162WI"}, "ts": "2023-07-06 21:50:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64613CO"}, "ts": "2023-07-06 21:50:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07293JT"}, "ts": "2023-07-06 21:50:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97083VO"}, "ts": "2023-07-06 21:50:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23654OQ"}, "ts": "2023-07-06 21:50:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11482NO"}, "ts": "2023-07-06 21:50:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07641UW"}, "ts": "2023-07-06 21:50:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12607115", "type": "PubMed"}, "ts": "2023-07-06 21:50:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12607115", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 21:50:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b0469959a9a5ae42ff62dcd16a4719a7", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:50:41 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b0469959a9a5ae42ff62dcd16a4719a7", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:50:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33772BZ"}, "ts": "2023-07-06 21:50:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51509AZ"}, "ts": "2023-07-06 21:50:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48367ZH"}, "ts": "2023-07-06 21:50:43 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b0469959a9a5ae42ff62dcd16a4719a7", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:50:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83415OS"}, "ts": "2023-07-06 21:50:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26400XV"}, "ts": "2023-07-06 21:50:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10508JF"}, "ts": "2023-07-06 21:50:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90089OR"}, "ts": "2023-07-06 21:50:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69041CZ"}, "ts": "2023-07-06 21:50:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36944VG"}, "ts": "2023-07-06 21:50:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13260WK"}, "ts": "2023-07-06 21:50:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25322NY"}, "ts": "2023-07-06 21:50:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83831AS"}, "ts": "2023-07-06 21:50:51 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b0469959a9a5ae42ff62dcd16a4719a7", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:50:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35749JN"}, "ts": "2023-07-06 21:50:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36431RU"}, "ts": "2023-07-06 21:50:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05690OR"}, "ts": "2023-07-06 21:50:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25024JR"}, "ts": "2023-07-06 21:50:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13885FQ"}, "ts": "2023-07-06 21:50:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99269VU"}, "ts": "2023-07-06 21:50:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62182KD"}, "ts": "2023-07-06 21:50:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23243LM"}, "ts": "2023-07-06 21:50:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88431RN"}, "ts": "2023-07-06 21:50:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03476LE"}, "ts": "2023-07-06 21:50:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59392WK"}, "ts": "2023-07-06 21:50:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27562JG"}, "ts": "2023-07-06 21:50:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93258UI"}, "ts": "2023-07-06 21:50:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31948FR"}, "ts": "2023-07-06 21:50:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09911WJ"}, "ts": "2023-07-06 21:50:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55700PF"}, "ts": "2023-07-06 21:50:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62930XL"}, "ts": "2023-07-06 21:50:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60382VE"}, "ts": "2023-07-06 21:50:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20697RD"}, "ts": "2023-07-06 21:50:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11980DL"}, "ts": "2023-07-06 21:50:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G23243LM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:51:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G23243LM"}, "ts": "2023-07-06 21:51:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10057RC"}, "ts": "2023-07-06 21:51:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66639WN"}, "ts": "2023-07-06 21:51:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G78059CC"}, "ts": "2023-07-06 21:51:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12368-1"}, "ts": "2023-07-06 21:51:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12368-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:51:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14157", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:51:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFW5-1"}, "ts": "2023-07-06 21:51:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFW5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:51:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:52:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYB4"}, "ts": "2023-07-06 21:52:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYB4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:52:12 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 21:52:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 21:52:49 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 21:52:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:52:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:52:50 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(2)Hex(2)dHex(1)NeuAc(1)", "term_category": "any"}, "ts": "2023-07-06 21:53:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:53:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">18a16319547faf218f1564307ec29cdc", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(2)Hex(2)dHex(1)NeuAc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:53:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18a16319547faf218f1564307ec29cdc", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:53:03 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "18a16319547faf218f1564307ec29cdc", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:53:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41245OZ"}, "ts": "2023-07-06 21:53:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49854OS"}, "ts": "2023-07-06 21:53:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78315FS"}, "ts": "2023-07-06 21:53:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91563MR"}, "ts": "2023-07-06 21:53:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75365RL"}, "ts": "2023-07-06 21:53:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22418PV"}, "ts": "2023-07-06 21:53:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77740PR"}, "ts": "2023-07-06 21:53:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63443GA"}, "ts": "2023-07-06 21:53:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80577OW"}, "ts": "2023-07-06 21:53:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59155GF"}, "ts": "2023-07-06 21:53:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20993TP"}, "ts": "2023-07-06 21:53:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29014XV"}, "ts": "2023-07-06 21:53:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92358PV"}, "ts": "2023-07-06 21:53:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93520MA"}, "ts": "2023-07-06 21:53:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03770HX"}, "ts": "2023-07-06 21:53:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36983SB"}, "ts": "2023-07-06 21:53:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52013SF"}, "ts": "2023-07-06 21:53:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85302NF"}, "ts": "2023-07-06 21:53:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42993UG"}, "ts": "2023-07-06 21:53:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44597NW"}, "ts": "2023-07-06 21:53:06 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "18a16319547faf218f1564307ec29cdc", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:53:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18a16319547faf218f1564307ec29cdc", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36588NK"}, "ts": "2023-07-06 21:53:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33278DK"}, "ts": "2023-07-06 21:53:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15876HU"}, "ts": "2023-07-06 21:53:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04351"}, "ts": "2023-07-06 21:53:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPA1"}, "ts": "2023-07-06 21:53:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPA1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:53:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49854OS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:53:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49854OS"}, "ts": "2023-07-06 21:53:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YD5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:53:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86YD5.272.272"}, "ts": "2023-07-06 21:53:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000018"}, "ts": "2023-07-06 21:53:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97887RK"}, "ts": "2023-07-06 21:53:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84800MW"}, "ts": "2023-07-06 21:53:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94827CQ"}, "ts": "2023-07-06 21:53:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2J0"}, "ts": "2023-07-06 21:54:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZGL3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:54:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZGL3"}, "ts": "2023-07-06 21:54:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G43417UB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:54:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-06 21:54:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G99844CS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:54:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G99844CS"}, "ts": "2023-07-06 21:54:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2KJ10-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:54:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2KJ10-1"}, "ts": "2023-07-06 21:54:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P36269.442.442"}, "ts": "2023-07-06 21:54:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36269", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:54:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07308-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:54:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02563", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:55:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q02563.80.80"}, "ts": "2023-07-06 21:55:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32089-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:55:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32089-1"}, "ts": "2023-07-06 21:55:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q70JA7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:55:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q70JA7"}, "ts": "2023-07-06 21:55:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95487", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:55:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95487.212.212"}, "ts": "2023-07-06 21:55:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 21:55:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07864", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 21:55:26 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P07864", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 21:55:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G09237BA"}, "ts": "2023-07-06 21:55:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G09237BA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:55:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 21:55:32 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 21:55:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:55:33 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 21:55:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:55:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07308-1"}, "ts": "2023-07-06 21:55:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:55:44 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(2)Hex(1)dHex(2)NeuGc(1)", "term_category": "any"}, "ts": "2023-07-06 21:55:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(2)Hex(1)dHex(2)NeuGc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:55:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29350"}, "ts": "2023-07-06 21:55:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29350"}, "ts": "2023-07-06 21:55:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:55:51 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(2)Hex(1)dHex(2)NeuGc(1)", "term_category": "any"}, "ts": "2023-07-06 21:55:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(2)Hex(1)dHex(2)NeuGc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:55:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12925201", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 21:56:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12925201", "type": "PubMed"}, "ts": "2023-07-06 21:56:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:56:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G99956MJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:56:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G99956MJ"}, "ts": "2023-07-06 21:56:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:56:18 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(2)Hex(1)dHex(2)NeuGc(1)", "term_category": "any"}, "ts": "2023-07-06 21:56:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(2)Hex(1)dHex(2)NeuGc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:56:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "K9J7B2-1"}, "ts": "2023-07-06 21:56:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "K9J7B2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:56:33 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(2)Hex(2)dHex(3)", "term_category": "any"}, "ts": "2023-07-06 21:56:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:56:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">8bbc0a6f3262a7367f71c4f895ec2c78", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(2)Hex(2)dHex(3)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:56:50 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8bbc0a6f3262a7367f71c4f895ec2c78", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:56:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8bbc0a6f3262a7367f71c4f895ec2c78", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:56:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21845NG"}, "ts": "2023-07-06 21:56:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74917JX"}, "ts": "2023-07-06 21:56:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74578MX"}, "ts": "2023-07-06 21:56:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98699SF"}, "ts": "2023-07-06 21:56:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75599HG"}, "ts": "2023-07-06 21:56:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26876TS"}, "ts": "2023-07-06 21:56:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15351FP"}, "ts": "2023-07-06 21:56:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47772RH"}, "ts": "2023-07-06 21:56:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18901ZN"}, "ts": "2023-07-06 21:56:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49742PU"}, "ts": "2023-07-06 21:56:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48092WH"}, "ts": "2023-07-06 21:56:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83421XZ"}, "ts": "2023-07-06 21:56:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41378OY"}, "ts": "2023-07-06 21:56:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23532XZ"}, "ts": "2023-07-06 21:56:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66565TB"}, "ts": "2023-07-06 21:56:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10192EN"}, "ts": "2023-07-06 21:56:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82362QD"}, "ts": "2023-07-06 21:56:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16479OO"}, "ts": "2023-07-06 21:56:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45452NJ"}, "ts": "2023-07-06 21:56:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21349JZ"}, "ts": "2023-07-06 21:56:53 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8bbc0a6f3262a7367f71c4f895ec2c78", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:56:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8bbc0a6f3262a7367f71c4f895ec2c78", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:56:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36047BO"}, "ts": "2023-07-06 21:56:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67531TM"}, "ts": "2023-07-06 21:56:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01532FF"}, "ts": "2023-07-06 21:56:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59498PG"}, "ts": "2023-07-06 21:56:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02442MH"}, "ts": "2023-07-06 21:56:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43001RF"}, "ts": "2023-07-06 21:56:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51071WE"}, "ts": "2023-07-06 21:56:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33079AA"}, "ts": "2023-07-06 21:56:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZTK2"}, "ts": "2023-07-06 21:56:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:57:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZTK2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:57:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G21845NG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:57:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G21845NG"}, "ts": "2023-07-06 21:57:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WUK6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:57:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000019"}, "ts": "2023-07-06 21:57:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WUK6-1"}, "ts": "2023-07-06 21:57:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000045"}, "ts": "2023-07-06 21:57:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99PF4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:57:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99PF4.1001.1001"}, "ts": "2023-07-06 21:57:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0V8T5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 21:57:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0V8T5"}, "ts": "2023-07-06 21:57:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G21072IJ"}, "ts": "2023-07-06 21:58:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G21072IJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:58:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N5G2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 21:58:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N5G2.631.631"}, "ts": "2023-07-06 21:58:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 21:58:38 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 21:58:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:58:39 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 21:58:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 21:58:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 21:58:46 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)Hex(1)dHex(1)NeuAc(1)", "term_category": "any"}, "ts": "2023-07-06 21:58:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">8bb84c672e1565044ab2abd00b3caa57", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)Hex(1)dHex(1)NeuAc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 21:58:47 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8bb84c672e1565044ab2abd00b3caa57", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 21:58:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8bb84c672e1565044ab2abd00b3caa57", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:58:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 21:58:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 21:58:48 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 21:58:48 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8bb84c672e1565044ab2abd00b3caa57", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:58:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8bb84c672e1565044ab2abd00b3caa57", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 21:58:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66991YE"}, "ts": "2023-07-06 21:58:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44342ZF"}, "ts": "2023-07-06 21:58:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17758YV"}, "ts": "2023-07-06 21:58:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81439BR"}, "ts": "2023-07-06 21:58:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78011OA"}, "ts": "2023-07-06 21:58:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92296LB"}, "ts": "2023-07-06 21:58:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06523WI"}, "ts": "2023-07-06 21:58:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43167FQ"}, "ts": "2023-07-06 21:58:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71409LF"}, "ts": "2023-07-06 21:58:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59659CN"}, "ts": "2023-07-06 21:58:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72304KR"}, "ts": "2023-07-06 21:58:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08366OY"}, "ts": "2023-07-06 21:58:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33669VL"}, "ts": "2023-07-06 21:58:58 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8bb84c672e1565044ab2abd00b3caa57", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:59:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84243HD"}, "ts": "2023-07-06 21:59:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55043JL"}, "ts": "2023-07-06 21:59:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58577QT"}, "ts": "2023-07-06 21:59:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86286CX"}, "ts": "2023-07-06 21:59:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47307MO"}, "ts": "2023-07-06 21:59:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74163WT"}, "ts": "2023-07-06 21:59:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11764PR"}, "ts": "2023-07-06 21:59:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03720YG"}, "ts": "2023-07-06 21:59:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36878RU"}, "ts": "2023-07-06 21:59:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21421FQ"}, "ts": "2023-07-06 21:59:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19913KF"}, "ts": "2023-07-06 21:59:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37175JP"}, "ts": "2023-07-06 21:59:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83885CD"}, "ts": "2023-07-06 21:59:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61921AV"}, "ts": "2023-07-06 21:59:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81041HS"}, "ts": "2023-07-06 21:59:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78695ET"}, "ts": "2023-07-06 21:59:09 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8bb84c672e1565044ab2abd00b3caa57", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 21:59:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45362KT"}, "ts": "2023-07-06 21:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51116JR"}, "ts": "2023-07-06 21:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51192NL"}, "ts": "2023-07-06 21:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16638ZZ"}, "ts": "2023-07-06 21:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35983RN"}, "ts": "2023-07-06 21:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18643HE"}, "ts": "2023-07-06 21:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35347WX"}, "ts": "2023-07-06 21:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23461QN"}, "ts": "2023-07-06 21:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64008QI"}, "ts": "2023-07-06 21:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77843RR"}, "ts": "2023-07-06 21:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16993HQ"}, "ts": "2023-07-06 21:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35212EI"}, "ts": "2023-07-06 21:59:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25865TC"}, "ts": "2023-07-06 21:59:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40624OC"}, "ts": "2023-07-06 21:59:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76993QS"}, "ts": "2023-07-06 21:59:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45579IH"}, "ts": "2023-07-06 21:59:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91447PN"}, "ts": "2023-07-06 21:59:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75834EU"}, "ts": "2023-07-06 21:59:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G16638ZZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 21:59:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G16638ZZ"}, "ts": "2023-07-06 21:59:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05127BN"}, "ts": "2023-07-06 21:59:28 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-06 22:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-06 22:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 22:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-06 22:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-06 22:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-06 22:00:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LXU3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:00:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LXU3-1"}, "ts": "2023-07-06 22:00:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQI0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:00:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQI0"}, "ts": "2023-07-06 22:00:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G88374WZ"}, "ts": "2023-07-06 22:00:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G40702WU"}, "ts": "2023-07-06 22:00:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H4F8"}, "ts": "2023-07-06 22:01:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H4F8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:01:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60832HV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:01:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G60832HV"}, "ts": "2023-07-06 22:01:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49155EM"}, "ts": "2023-07-06 22:01:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49155EM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:01:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17472575", "type": "PubMed"}, "ts": "2023-07-06 22:01:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17472575", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 22:01:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G12944WQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:02:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G12944WQ"}, "ts": "2023-07-06 22:02:47 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 22:02:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 22:02:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N697"}, "ts": "2023-07-06 22:02:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:02:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N697", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:02:52 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 22:02:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:02:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4V7F5-1"}, "ts": "2023-07-06 22:02:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4V7F5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:03:02 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)Hex(1)dHex(1)NeuGc(1)", "term_category": "any"}, "ts": "2023-07-06 22:03:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 22:03:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">39c6e6b95a8afb47a920fb91664a8feb", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)Hex(1)dHex(1)NeuGc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 22:03:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "39c6e6b95a8afb47a920fb91664a8feb", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:03:03 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "39c6e6b95a8afb47a920fb91664a8feb", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:03:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99356PZ"}, "ts": "2023-07-06 22:03:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67728UJ"}, "ts": "2023-07-06 22:03:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17751FJ"}, "ts": "2023-07-06 22:03:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29159BL"}, "ts": "2023-07-06 22:03:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93265QH"}, "ts": "2023-07-06 22:03:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66634LZ"}, "ts": "2023-07-06 22:03:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24094XC"}, "ts": "2023-07-06 22:03:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52783KP"}, "ts": "2023-07-06 22:03:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27419MQ"}, "ts": "2023-07-06 22:03:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13444XN"}, "ts": "2023-07-06 22:03:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67776JA"}, "ts": "2023-07-06 22:03:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18694JB"}, "ts": "2023-07-06 22:03:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94450ZJ"}, "ts": "2023-07-06 22:03:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04501IZ"}, "ts": "2023-07-06 22:03:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89612MM"}, "ts": "2023-07-06 22:03:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25601BM"}, "ts": "2023-07-06 22:03:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62259PP"}, "ts": "2023-07-06 22:03:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82489VA"}, "ts": "2023-07-06 22:03:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87557PZ"}, "ts": "2023-07-06 22:03:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06022DR"}, "ts": "2023-07-06 22:03:06 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "39c6e6b95a8afb47a920fb91664a8feb", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:03:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74184ES"}, "ts": "2023-07-06 22:03:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24798VC"}, "ts": "2023-07-06 22:03:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31859FU"}, "ts": "2023-07-06 22:03:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31736JN"}, "ts": "2023-07-06 22:03:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16873EX"}, "ts": "2023-07-06 22:03:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98101PA"}, "ts": "2023-07-06 22:03:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76248KB"}, "ts": "2023-07-06 22:03:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26114FB"}, "ts": "2023-07-06 22:03:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18476BB"}, "ts": "2023-07-06 22:03:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71746IN"}, "ts": "2023-07-06 22:03:14 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "39c6e6b95a8afb47a920fb91664a8feb", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": []}, "ts": "2023-07-06 22:03:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20392MD"}, "ts": "2023-07-06 22:03:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q10981"}, "ts": "2023-07-06 22:03:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NV64", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:03:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NV64"}, "ts": "2023-07-06 22:03:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04671"}, "ts": "2023-07-06 22:03:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15231720", "type": "PubMed"}, "ts": "2023-07-06 22:03:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15231720", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 22:03:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 22:03:39 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 22:03:39 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 22:03:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:03:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:03:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92854", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:03:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92854.74.74"}, "ts": "2023-07-06 22:03:48 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(1)HexNAc(3)dHex(1)NeuGc(1)", "term_category": "any"}, "ts": "2023-07-06 22:03:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 22:03:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">e8218bf29e0c9aea2581667accc2992a", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(1)HexNAc(3)dHex(1)NeuGc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 22:03:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G48044RX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:03:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G48044RX"}, "ts": "2023-07-06 22:03:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "e8218bf29e0c9aea2581667accc2992a", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:03:52 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "e8218bf29e0c9aea2581667accc2992a", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:03:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q10980"}, "ts": "2023-07-06 22:03:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32602654", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 22:03:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32602654", "type": "PubMed"}, "ts": "2023-07-06 22:03:55 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "e8218bf29e0c9aea2581667accc2992a", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:03:55 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "e8218bf29e0c9aea2581667accc2992a", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": []}, "ts": "2023-07-06 22:03:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NW07.215.215"}, "ts": "2023-07-06 22:03:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NW07", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:04:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 22:04:16 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 22:04:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:04:19 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 22:04:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:04:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66H38"}, "ts": "2023-07-06 22:04:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66H38", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:04:28 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)Hex(2)dHex(2)", "term_category": "any"}, "ts": "2023-07-06 22:04:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 22:04:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">1a296ba04583590fa5542a264053271e", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)Hex(2)dHex(2)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 22:04:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1a296ba04583590fa5542a264053271e", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:04:29 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "1a296ba04583590fa5542a264053271e", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:04:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36004BS"}, "ts": "2023-07-06 22:04:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56555MU"}, "ts": "2023-07-06 22:04:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24068UY"}, "ts": "2023-07-06 22:04:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92709EO"}, "ts": "2023-07-06 22:04:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26421QW"}, "ts": "2023-07-06 22:04:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52956BX"}, "ts": "2023-07-06 22:04:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64468KS"}, "ts": "2023-07-06 22:04:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28550OD"}, "ts": "2023-07-06 22:04:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17977UE"}, "ts": "2023-07-06 22:04:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49401CB"}, "ts": "2023-07-06 22:04:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70387YT"}, "ts": "2023-07-06 22:04:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10425SO"}, "ts": "2023-07-06 22:04:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79781PS"}, "ts": "2023-07-06 22:04:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24668UI"}, "ts": "2023-07-06 22:04:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61291WY"}, "ts": "2023-07-06 22:04:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27188NC"}, "ts": "2023-07-06 22:04:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16604UX"}, "ts": "2023-07-06 22:04:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44572NU"}, "ts": "2023-07-06 22:04:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51586BA"}, "ts": "2023-07-06 22:04:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1a296ba04583590fa5542a264053271e", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:04:34 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "1a296ba04583590fa5542a264053271e", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:04:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12035CL"}, "ts": "2023-07-06 22:04:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31317XB"}, "ts": "2023-07-06 22:04:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98007XA"}, "ts": "2023-07-06 22:04:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29166US"}, "ts": "2023-07-06 22:04:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28116PK"}, "ts": "2023-07-06 22:04:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02032MW"}, "ts": "2023-07-06 22:04:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39326PP"}, "ts": "2023-07-06 22:04:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49228QV"}, "ts": "2023-07-06 22:04:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99236CU"}, "ts": "2023-07-06 22:04:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97840DJ"}, "ts": "2023-07-06 22:04:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34168KI"}, "ts": "2023-07-06 22:04:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21297DP"}, "ts": "2023-07-06 22:04:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78928PU"}, "ts": "2023-07-06 22:04:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90689AW"}, "ts": "2023-07-06 22:04:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19238ZQ"}, "ts": "2023-07-06 22:04:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41324RH"}, "ts": "2023-07-06 22:04:36 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "1a296ba04583590fa5542a264053271e", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:04:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38785NI"}, "ts": "2023-07-06 22:04:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47330ZJ"}, "ts": "2023-07-06 22:04:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31721SH"}, "ts": "2023-07-06 22:04:57 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "1a296ba04583590fa5542a264053271e", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:04:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10514PF"}, "ts": "2023-07-06 22:04:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46960TX"}, "ts": "2023-07-06 22:04:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93909NH"}, "ts": "2023-07-06 22:04:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05892LT"}, "ts": "2023-07-06 22:04:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99657DS"}, "ts": "2023-07-06 22:04:59 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "1a296ba04583590fa5542a264053271e", "offset": 41, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:05:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45518GL"}, "ts": "2023-07-06 22:05:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17733ZN"}, "ts": "2023-07-06 22:05:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66621SE"}, "ts": "2023-07-06 22:05:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48129FF"}, "ts": "2023-07-06 22:05:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93090IR"}, "ts": "2023-07-06 22:05:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37134CP"}, "ts": "2023-07-06 22:05:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30464XN"}, "ts": "2023-07-06 22:05:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18584GV"}, "ts": "2023-07-06 22:05:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41552FO"}, "ts": "2023-07-06 22:05:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35252ME"}, "ts": "2023-07-06 22:05:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63499JS"}, "ts": "2023-07-06 22:05:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20372QO"}, "ts": "2023-07-06 22:05:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44506WQ"}, "ts": "2023-07-06 22:05:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07943FD"}, "ts": "2023-07-06 22:05:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88555AB"}, "ts": "2023-07-06 22:05:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68384KC"}, "ts": "2023-07-06 22:05:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29418HB"}, "ts": "2023-07-06 22:05:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06194QO"}, "ts": "2023-07-06 22:05:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66271TT"}, "ts": "2023-07-06 22:05:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G88555AB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:05:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G88555AB"}, "ts": "2023-07-06 22:05:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30849228", "type": "PubMed"}, "ts": "2023-07-06 22:05:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30849228", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 22:05:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30849228", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 22:05:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G58251ZG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:06:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58251ZG"}, "ts": "2023-07-06 22:06:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A0W4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:06:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A0W4-1"}, "ts": "2023-07-06 22:06:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-06 22:06:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G29068FM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:06:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P82979.163.163"}, "ts": "2023-07-06 22:07:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50294"}, "ts": "2023-07-06 22:07:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P82979", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:07:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14917"}, "ts": "2023-07-06 22:07:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14917", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:07:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 22:07:32 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 22:07:32 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 22:07:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:07:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:07:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 22:07:40 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(2)Hex(2)dHex(2)NeuAc(1)", "term_category": "any"}, "ts": "2023-07-06 22:07:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">7597bfcaa4e32f9a5b9b09eca9591f26", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(2)Hex(2)dHex(2)NeuAc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 22:07:41 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "7597bfcaa4e32f9a5b9b09eca9591f26", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:07:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7597bfcaa4e32f9a5b9b09eca9591f26", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:07:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43059PA"}, "ts": "2023-07-06 22:07:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19619KS"}, "ts": "2023-07-06 22:07:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90221FQ"}, "ts": "2023-07-06 22:07:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55184IL"}, "ts": "2023-07-06 22:07:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45215IJ"}, "ts": "2023-07-06 22:07:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37239FO"}, "ts": "2023-07-06 22:07:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61785RY"}, "ts": "2023-07-06 22:07:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03098CZ"}, "ts": "2023-07-06 22:07:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08431YY"}, "ts": "2023-07-06 22:07:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45685DY"}, "ts": "2023-07-06 22:07:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11655BA"}, "ts": "2023-07-06 22:07:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66512FS"}, "ts": "2023-07-06 22:07:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15249CA"}, "ts": "2023-07-06 22:07:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89008DB"}, "ts": "2023-07-06 22:07:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69360KJ"}, "ts": "2023-07-06 22:07:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53203KV"}, "ts": "2023-07-06 22:07:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62658XM"}, "ts": "2023-07-06 22:07:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31806HV"}, "ts": "2023-07-06 22:07:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78034AU"}, "ts": "2023-07-06 22:07:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85721WE"}, "ts": "2023-07-06 22:07:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7597bfcaa4e32f9a5b9b09eca9591f26", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:07:46 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "7597bfcaa4e32f9a5b9b09eca9591f26", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:07:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50613GW"}, "ts": "2023-07-06 22:07:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83134ZR"}, "ts": "2023-07-06 22:07:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92288VL"}, "ts": "2023-07-06 22:07:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61778ST"}, "ts": "2023-07-06 22:07:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66699QG"}, "ts": "2023-07-06 22:07:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31087MR"}, "ts": "2023-07-06 22:07:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66945SJ"}, "ts": "2023-07-06 22:07:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58543HQ"}, "ts": "2023-07-06 22:07:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25844GR"}, "ts": "2023-07-06 22:07:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75407SV"}, "ts": "2023-07-06 22:07:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84360YQ"}, "ts": "2023-07-06 22:07:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56256KD"}, "ts": "2023-07-06 22:07:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54347OK"}, "ts": "2023-07-06 22:07:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74091BP"}, "ts": "2023-07-06 22:07:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G43059PA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:07:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G43059PA"}, "ts": "2023-07-06 22:07:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52927ST"}, "ts": "2023-07-06 22:07:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09858ME"}, "ts": "2023-07-06 22:07:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LV18"}, "ts": "2023-07-06 22:08:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LV18", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:08:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16455", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:08:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16455"}, "ts": "2023-07-06 22:08:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04351", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:09:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZKT3-1"}, "ts": "2023-07-06 22:09:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZKT3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:09:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 22:09:24 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 22:09:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:09:25 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 22:09:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:09:25 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)Hex(2)dHex(1)NeuAc(1)", "term_category": "any"}, "ts": "2023-07-06 22:09:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 22:09:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">4c296a0240525fd579df818dea081703", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)Hex(2)dHex(1)NeuAc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 22:09:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4c296a0240525fd579df818dea081703", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:09:35 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "4c296a0240525fd579df818dea081703", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:09:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WVM8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:09:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47152AG"}, "ts": "2023-07-06 22:09:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75500ME"}, "ts": "2023-07-06 22:09:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59674PZ"}, "ts": "2023-07-06 22:09:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76526WR"}, "ts": "2023-07-06 22:09:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94260JY"}, "ts": "2023-07-06 22:09:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61887JK"}, "ts": "2023-07-06 22:09:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07226NI"}, "ts": "2023-07-06 22:09:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30090XJ"}, "ts": "2023-07-06 22:09:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42208HH"}, "ts": "2023-07-06 22:09:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84104VL"}, "ts": "2023-07-06 22:09:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40319SF"}, "ts": "2023-07-06 22:09:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92115RL"}, "ts": "2023-07-06 22:09:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WVM8"}, "ts": "2023-07-06 22:09:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G29857RC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:09:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 22:09:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M862-1"}, "ts": "2023-07-06 22:09:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M862-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 22:09:55 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "4c296a0240525fd579df818dea081703", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:09:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4c296a0240525fd579df818dea081703", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:09:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G10924UK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:10:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10924UK"}, "ts": "2023-07-06 22:10:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000005"}, "ts": "2023-07-06 22:10:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58590EJ"}, "ts": "2023-07-06 22:10:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19330030", "type": "PubMed"}, "ts": "2023-07-06 22:10:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19330030", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 22:10:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q53QZ3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:10:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q53QZ3.378.378"}, "ts": "2023-07-06 22:10:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19022"}, "ts": "2023-07-06 22:10:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19022", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:10:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H306", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:10:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H306.309.309"}, "ts": "2023-07-06 22:10:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWB7"}, "ts": "2023-07-06 22:11:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWB7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:11:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZP8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:11:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZP8"}, "ts": "2023-07-06 22:11:18 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 22:11:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 22:11:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:11:30 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 22:11:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:11:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29350", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:11:31 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)Hex(2)dHex(3)", "term_category": "any"}, "ts": "2023-07-06 22:11:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 22:11:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">27d88a7d20d8b313c77d4f5baaa34cb5", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)Hex(2)dHex(3)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 22:11:38 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "27d88a7d20d8b313c77d4f5baaa34cb5", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:11:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27d88a7d20d8b313c77d4f5baaa34cb5", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:11:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31849TV"}, "ts": "2023-07-06 22:11:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40689UV"}, "ts": "2023-07-06 22:11:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69799LR"}, "ts": "2023-07-06 22:11:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43993DD"}, "ts": "2023-07-06 22:11:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96349RY"}, "ts": "2023-07-06 22:11:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66184ZO"}, "ts": "2023-07-06 22:11:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89058HG"}, "ts": "2023-07-06 22:11:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78511GS"}, "ts": "2023-07-06 22:11:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60282OI"}, "ts": "2023-07-06 22:11:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39643KO"}, "ts": "2023-07-06 22:11:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18837VD"}, "ts": "2023-07-06 22:11:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46617YI"}, "ts": "2023-07-06 22:11:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09060TD"}, "ts": "2023-07-06 22:11:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210-1"}, "ts": "2023-07-06 22:11:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67984UO"}, "ts": "2023-07-06 22:11:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21835FP"}, "ts": "2023-07-06 22:11:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88066NH"}, "ts": "2023-07-06 22:11:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64591MN"}, "ts": "2023-07-06 22:11:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16915GU"}, "ts": "2023-07-06 22:11:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18117YG"}, "ts": "2023-07-06 22:11:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G31849TV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:11:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G31849TV"}, "ts": "2023-07-06 22:11:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58195CE"}, "ts": "2023-07-06 22:11:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BVL2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:11:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BVL2.143.143"}, "ts": "2023-07-06 22:11:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1303260", "type": "PubMed"}, "ts": "2023-07-06 22:12:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1303260", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 22:12:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 22:12:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P26373.45.45"}, "ts": "2023-07-06 22:12:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26373", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:12:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R835-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:12:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R835-1"}, "ts": "2023-07-06 22:12:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35386", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:12:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35386"}, "ts": "2023-07-06 22:12:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05863AA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:13:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05863AA"}, "ts": "2023-07-06 22:13:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7L3B6"}, "ts": "2023-07-06 22:13:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L3B6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:13:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q32MQ0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:13:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q32MQ0.705.705"}, "ts": "2023-07-06 22:13:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 22:13:45 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 22:13:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:13:45 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 22:13:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:13:46 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)Hex(3)NeuAc(1)", "term_category": "any"}, "ts": "2023-07-06 22:13:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 22:13:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">c2d3353b6ebc2096e621a38a36cc549f", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)Hex(3)NeuAc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 22:13:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "c2d3353b6ebc2096e621a38a36cc549f", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:13:49 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "c2d3353b6ebc2096e621a38a36cc549f", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:13:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26344OO"}, "ts": "2023-07-06 22:13:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47681UP"}, "ts": "2023-07-06 22:13:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52706RS"}, "ts": "2023-07-06 22:13:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08776GA"}, "ts": "2023-07-06 22:13:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28096RS"}, "ts": "2023-07-06 22:13:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64919UI"}, "ts": "2023-07-06 22:13:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94941PK"}, "ts": "2023-07-06 22:13:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97823XK"}, "ts": "2023-07-06 22:13:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92147QP"}, "ts": "2023-07-06 22:13:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53151WW"}, "ts": "2023-07-06 22:13:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G66419SM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:14:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G66419SM"}, "ts": "2023-07-06 22:14:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49155EM"}, "ts": "2023-07-06 22:14:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82408LA"}, "ts": "2023-07-06 22:14:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20523OQ"}, "ts": "2023-07-06 22:14:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQ65", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:14:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TQ65"}, "ts": "2023-07-06 22:14:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:14:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96SZ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:14:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96SZ5"}, "ts": "2023-07-06 22:14:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43007"}, "ts": "2023-07-06 22:14:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:15:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43007", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:15:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18960KY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:15:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18960KY"}, "ts": "2023-07-06 22:15:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5DX21", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:15:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5DX21"}, "ts": "2023-07-06 22:15:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3E5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:15:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3E5"}, "ts": "2023-07-06 22:15:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 22:15:28 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 22:15:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:15:28 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 22:15:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:15:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 22:15:40 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)Hex(3)dHex(2)", "term_category": "any"}, "ts": "2023-07-06 22:15:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">c6e60ea668b02354fbf4c404f08929f3", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)Hex(3)dHex(2)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 22:15:40 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "c6e60ea668b02354fbf4c404f08929f3", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:15:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "c6e60ea668b02354fbf4c404f08929f3", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:15:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87668ED"}, "ts": "2023-07-06 22:15:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00706QN"}, "ts": "2023-07-06 22:15:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90974OF"}, "ts": "2023-07-06 22:15:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43638GS"}, "ts": "2023-07-06 22:15:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18999DB"}, "ts": "2023-07-06 22:15:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73089GA"}, "ts": "2023-07-06 22:15:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41720HN"}, "ts": "2023-07-06 22:15:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89117DH"}, "ts": "2023-07-06 22:15:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31416KB"}, "ts": "2023-07-06 22:15:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28654UV"}, "ts": "2023-07-06 22:15:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36699DD"}, "ts": "2023-07-06 22:15:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46746GZ"}, "ts": "2023-07-06 22:15:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65447JX"}, "ts": "2023-07-06 22:15:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64518MK"}, "ts": "2023-07-06 22:15:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00272VU"}, "ts": "2023-07-06 22:15:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04099VY"}, "ts": "2023-07-06 22:15:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34239064", "type": "PubMed"}, "ts": "2023-07-06 22:15:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34239064", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 22:15:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 22:15:53 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "c6e60ea668b02354fbf4c404f08929f3", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:16:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "c6e60ea668b02354fbf4c404f08929f3", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:16:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62741IO"}, "ts": "2023-07-06 22:16:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64165TJ"}, "ts": "2023-07-06 22:16:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51557QE"}, "ts": "2023-07-06 22:16:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94705OR"}, "ts": "2023-07-06 22:16:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60341PX"}, "ts": "2023-07-06 22:16:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82693QG"}, "ts": "2023-07-06 22:16:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69479TC"}, "ts": "2023-07-06 22:16:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46500XL"}, "ts": "2023-07-06 22:16:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81832XS"}, "ts": "2023-07-06 22:16:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12365RQ"}, "ts": "2023-07-06 22:16:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G28116PK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:16:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G28116PK"}, "ts": "2023-07-06 22:16:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000021"}, "ts": "2023-07-06 22:16:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000020"}, "ts": "2023-07-06 22:16:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000042"}, "ts": "2023-07-06 22:16:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28997IA"}, "ts": "2023-07-06 22:16:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48181XF"}, "ts": "2023-07-06 22:16:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16558ON"}, "ts": "2023-07-06 22:16:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04003"}, "ts": "2023-07-06 22:16:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7M733-1"}, "ts": "2023-07-06 22:16:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7M733-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:16:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z2H8"}, "ts": "2023-07-06 22:16:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z2H8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:16:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00472", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:16:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00472.580.580"}, "ts": "2023-07-06 22:16:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G88374WZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:16:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P232"}, "ts": "2023-07-06 22:16:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:16:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P232", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:16:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CU9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:16:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CU9"}, "ts": "2023-07-06 22:16:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00613"}, "ts": "2023-07-06 22:16:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-06 22:16:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43089EG"}, "ts": "2023-07-06 22:16:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-06 22:16:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-06 22:16:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G40702WU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:16:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19224", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:17:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19224"}, "ts": "2023-07-06 22:17:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RZ29-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:17:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RZ29-1"}, "ts": "2023-07-06 22:17:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B3DM97-1"}, "ts": "2023-07-06 22:17:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B3DM97-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:17:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 22:17:49 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 22:17:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:17:49 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 22:17:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:17:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 22:17:59 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(4)Hex(2)dHex(2)", "term_category": "any"}, "ts": "2023-07-06 22:17:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">3804ef5f487459a390dd69a72f04c03c", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(4)Hex(2)dHex(2)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 22:17:59 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3804ef5f487459a390dd69a72f04c03c", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:18:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3804ef5f487459a390dd69a72f04c03c", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:18:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3804ef5f487459a390dd69a72f04c03c", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:18:05 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3804ef5f487459a390dd69a72f04c03c", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:18:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38316MW"}, "ts": "2023-07-06 22:18:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59951KW"}, "ts": "2023-07-06 22:18:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50619VO"}, "ts": "2023-07-06 22:18:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07443RM"}, "ts": "2023-07-06 22:18:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20713UI"}, "ts": "2023-07-06 22:18:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64305XQ"}, "ts": "2023-07-06 22:18:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51020FB"}, "ts": "2023-07-06 22:18:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3X9I0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:18:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85393KI"}, "ts": "2023-07-06 22:18:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79222ND"}, "ts": "2023-07-06 22:18:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3X9I0"}, "ts": "2023-07-06 22:18:07 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3804ef5f487459a390dd69a72f04c03c", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:18:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52512BG"}, "ts": "2023-07-06 22:18:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16468EC"}, "ts": "2023-07-06 22:18:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58201OX"}, "ts": "2023-07-06 22:18:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47709SA"}, "ts": "2023-07-06 22:18:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96104TD"}, "ts": "2023-07-06 22:18:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91368WO"}, "ts": "2023-07-06 22:18:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34495VW"}, "ts": "2023-07-06 22:18:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31540HC"}, "ts": "2023-07-06 22:18:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45604PU"}, "ts": "2023-07-06 22:18:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88254XP"}, "ts": "2023-07-06 22:18:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38702PM"}, "ts": "2023-07-06 22:18:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13101AX"}, "ts": "2023-07-06 22:18:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10954DW"}, "ts": "2023-07-06 22:18:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25146DY"}, "ts": "2023-07-06 22:18:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68686HN"}, "ts": "2023-07-06 22:18:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51653BI"}, "ts": "2023-07-06 22:18:15 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3804ef5f487459a390dd69a72f04c03c", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:18:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47359DC"}, "ts": "2023-07-06 22:18:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51809TM"}, "ts": "2023-07-06 22:18:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75655AB"}, "ts": "2023-07-06 22:18:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08678VD"}, "ts": "2023-07-06 22:18:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76299ZG"}, "ts": "2023-07-06 22:18:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32785BQ"}, "ts": "2023-07-06 22:18:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57471CR"}, "ts": "2023-07-06 22:18:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42245KI"}, "ts": "2023-07-06 22:18:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94201BI"}, "ts": "2023-07-06 22:18:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64876LY"}, "ts": "2023-07-06 22:18:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18315KI"}, "ts": "2023-07-06 22:18:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28570DO"}, "ts": "2023-07-06 22:18:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42752PT"}, "ts": "2023-07-06 22:18:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98473NJ"}, "ts": "2023-07-06 22:18:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00729SA"}, "ts": "2023-07-06 22:18:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40407UW"}, "ts": "2023-07-06 22:18:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75547HK"}, "ts": "2023-07-06 22:18:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66460UY"}, "ts": "2023-07-06 22:18:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16459CO"}, "ts": "2023-07-06 22:18:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83163SN"}, "ts": "2023-07-06 22:18:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G08678VD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:18:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G08678VD"}, "ts": "2023-07-06 22:18:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08881.59.59"}, "ts": "2023-07-06 22:18:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08881", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:18:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NHY2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:18:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13716"}, "ts": "2023-07-06 22:18:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:19:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13716", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:19:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:19:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35749"}, "ts": "2023-07-06 22:19:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35749", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:19:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10981", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:19:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04671", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:19:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10980", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:19:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 22:19:55 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 22:19:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:19:56 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 22:19:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:19:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 22:19:59 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)Hex(2)NeuAc(2)", "term_category": "any"}, "ts": "2023-07-06 22:19:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">559a12895b5faee15928961b61c12fd2", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)Hex(2)NeuAc(2)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 22:20:00 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "559a12895b5faee15928961b61c12fd2", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:20:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "559a12895b5faee15928961b61c12fd2", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:20:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61119KT"}, "ts": "2023-07-06 22:20:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55144QZ"}, "ts": "2023-07-06 22:20:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80176YK"}, "ts": "2023-07-06 22:20:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17810KS"}, "ts": "2023-07-06 22:20:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02562EQ"}, "ts": "2023-07-06 22:20:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25835YC"}, "ts": "2023-07-06 22:20:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70590VH"}, "ts": "2023-07-06 22:20:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00241VQ"}, "ts": "2023-07-06 22:20:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83546KK"}, "ts": "2023-07-06 22:20:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97841LZ"}, "ts": "2023-07-06 22:20:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29988NK"}, "ts": "2023-07-06 22:20:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42650PV"}, "ts": "2023-07-06 22:20:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35896AC"}, "ts": "2023-07-06 22:20:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01282UD"}, "ts": "2023-07-06 22:20:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "559a12895b5faee15928961b61c12fd2", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:20:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97746VZ"}, "ts": "2023-07-06 22:20:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20899EQ"}, "ts": "2023-07-06 22:20:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94416QP"}, "ts": "2023-07-06 22:20:11 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "559a12895b5faee15928961b61c12fd2", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": []}, "ts": "2023-07-06 22:20:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09588MX"}, "ts": "2023-07-06 22:20:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20887HP"}, "ts": "2023-07-06 22:20:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47459CP"}, "ts": "2023-07-06 22:20:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11061BV"}, "ts": "2023-07-06 22:20:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99196VL"}, "ts": "2023-07-06 22:20:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27730BR"}, "ts": "2023-07-06 22:20:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72614KG"}, "ts": "2023-07-06 22:20:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82862JX"}, "ts": "2023-07-06 22:20:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16687RY"}, "ts": "2023-07-06 22:20:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28640WB"}, "ts": "2023-07-06 22:20:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46016EN"}, "ts": "2023-07-06 22:20:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46014PJ"}, "ts": "2023-07-06 22:20:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "559a12895b5faee15928961b61c12fd2", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:20:19 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "559a12895b5faee15928961b61c12fd2", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:20:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17810KS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:20:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17810KS"}, "ts": "2023-07-06 22:20:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23293FT"}, "ts": "2023-07-06 22:20:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09428", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:21:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:21:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16790"}, "ts": "2023-07-06 22:21:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16790", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:21:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q09428.1440.1440"}, "ts": "2023-07-06 22:21:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:22:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BUR4"}, "ts": "2023-07-06 22:22:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BUR4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:22:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 22:22:03 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 22:22:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:22:04 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 22:22:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:22:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09666", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:22:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q09666.1066.1066"}, "ts": "2023-07-06 22:22:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 22:22:15 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)Hex(2)dHex(2)NeuAc(1)", "term_category": "any"}, "ts": "2023-07-06 22:22:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">8758b283fe43d44fcd1418a6aaa587d2", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)Hex(2)dHex(2)NeuAc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 22:22:16 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8758b283fe43d44fcd1418a6aaa587d2", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:22:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8758b283fe43d44fcd1418a6aaa587d2", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:22:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70961NC"}, "ts": "2023-07-06 22:22:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71569SN"}, "ts": "2023-07-06 22:22:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18244ZK"}, "ts": "2023-07-06 22:22:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35235RT"}, "ts": "2023-07-06 22:22:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79701IE"}, "ts": "2023-07-06 22:22:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45570JA"}, "ts": "2023-07-06 22:22:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40103VO"}, "ts": "2023-07-06 22:22:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75030WH"}, "ts": "2023-07-06 22:22:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49691SV"}, "ts": "2023-07-06 22:22:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44310IT"}, "ts": "2023-07-06 22:22:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25815IN"}, "ts": "2023-07-06 22:22:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59995RD"}, "ts": "2023-07-06 22:22:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78929WE"}, "ts": "2023-07-06 22:22:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95142MK"}, "ts": "2023-07-06 22:22:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41607QV"}, "ts": "2023-07-06 22:22:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73394KQ"}, "ts": "2023-07-06 22:22:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24578GW"}, "ts": "2023-07-06 22:22:19 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8758b283fe43d44fcd1418a6aaa587d2", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:22:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62776HF"}, "ts": "2023-07-06 22:22:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35520YO"}, "ts": "2023-07-06 22:22:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44219AA"}, "ts": "2023-07-06 22:22:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66599VX"}, "ts": "2023-07-06 22:22:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71854TX"}, "ts": "2023-07-06 22:22:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72505BU"}, "ts": "2023-07-06 22:22:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87193FV"}, "ts": "2023-07-06 22:22:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92487IZ"}, "ts": "2023-07-06 22:22:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11524CG"}, "ts": "2023-07-06 22:22:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16495ZV"}, "ts": "2023-07-06 22:22:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78263DG"}, "ts": "2023-07-06 22:22:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90133IH"}, "ts": "2023-07-06 22:22:21 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8758b283fe43d44fcd1418a6aaa587d2", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:22:21 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8758b283fe43d44fcd1418a6aaa587d2", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:22:25 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8758b283fe43d44fcd1418a6aaa587d2", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": []}, "ts": "2023-07-06 22:22:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88780VN"}, "ts": "2023-07-06 22:22:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39676NA"}, "ts": "2023-07-06 22:22:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61435KZ"}, "ts": "2023-07-06 22:22:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37983TD"}, "ts": "2023-07-06 22:22:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42853VA"}, "ts": "2023-07-06 22:22:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70589IM"}, "ts": "2023-07-06 22:22:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93985ZS"}, "ts": "2023-07-06 22:22:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26696QO"}, "ts": "2023-07-06 22:22:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57132JE"}, "ts": "2023-07-06 22:22:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25869ML"}, "ts": "2023-07-06 22:22:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16495LU"}, "ts": "2023-07-06 22:22:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21200QC"}, "ts": "2023-07-06 22:22:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70647PV"}, "ts": "2023-07-06 22:22:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8758b283fe43d44fcd1418a6aaa587d2", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:22:32 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8758b283fe43d44fcd1418a6aaa587d2", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:22:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08805HB"}, "ts": "2023-07-06 22:22:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24123DL"}, "ts": "2023-07-06 22:22:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90135ZJ"}, "ts": "2023-07-06 22:22:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10199RS"}, "ts": "2023-07-06 22:22:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44159MM"}, "ts": "2023-07-06 22:22:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BWD1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:22:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BWD1"}, "ts": "2023-07-06 22:22:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G70589IM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:22:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G70589IM"}, "ts": "2023-07-06 22:22:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84116AK"}, "ts": "2023-07-06 22:22:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B5DEJ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:22:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B5DEJ2"}, "ts": "2023-07-06 22:22:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11842113", "type": "PubMed"}, "ts": "2023-07-06 22:22:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11842113", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 22:22:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50294", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:22:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G63840IZ"}, "ts": "2023-07-06 22:23:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G63840IZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:23:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8758b283fe43d44fcd1418a6aaa587d2", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:23:21 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8758b283fe43d44fcd1418a6aaa587d2", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:23:21 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8758b283fe43d44fcd1418a6aaa587d2", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:23:25 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8758b283fe43d44fcd1418a6aaa587d2", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": []}, "ts": "2023-07-06 22:23:27 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 22:24:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 22:24:11 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 22:24:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:24:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:24:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 22:24:27 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)Hex(3)dHex(1)NeuAc(1)", "term_category": "any"}, "ts": "2023-07-06 22:24:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">da630abf3d1c00dc3302b87db24d0c73", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)Hex(3)dHex(1)NeuAc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 22:24:28 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "da630abf3d1c00dc3302b87db24d0c73", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:24:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "da630abf3d1c00dc3302b87db24d0c73", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:24:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78482IS"}, "ts": "2023-07-06 22:24:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22773YW"}, "ts": "2023-07-06 22:24:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04130SK"}, "ts": "2023-07-06 22:24:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29628MO"}, "ts": "2023-07-06 22:24:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52971SZ"}, "ts": "2023-07-06 22:24:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88204LN"}, "ts": "2023-07-06 22:24:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "da630abf3d1c00dc3302b87db24d0c73", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:24:32 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "da630abf3d1c00dc3302b87db24d0c73", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:24:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16610", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:24:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16610.138.138"}, "ts": "2023-07-06 22:24:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67384KH"}, "ts": "2023-07-06 22:24:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15635CJ"}, "ts": "2023-07-06 22:24:33 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "da630abf3d1c00dc3302b87db24d0c73", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:24:35 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "da630abf3d1c00dc3302b87db24d0c73", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:24:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9115292", "type": "PubMed"}, "ts": "2023-07-06 22:24:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9115292", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 22:24:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969X2"}, "ts": "2023-07-06 22:24:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969X2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:24:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G81439BR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:25:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G81439BR"}, "ts": "2023-07-06 22:25:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49695NW"}, "ts": "2023-07-06 22:25:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28731PH"}, "ts": "2023-07-06 22:25:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30846987", "type": "PubMed"}, "ts": "2023-07-06 22:25:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30846987", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 22:25:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33533043", "type": "PubMed"}, "ts": "2023-07-06 22:25:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 22:25:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33533043", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 22:25:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NS73", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:25:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NS73"}, "ts": "2023-07-06 22:25:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6W3E5"}, "ts": "2023-07-06 22:26:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-06 22:26:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 22:26:22 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 22:26:22 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 22:26:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:26:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:26:23 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)Hex(3)dHex(3)", "term_category": "any"}, "ts": "2023-07-06 22:26:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 22:26:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">f86bb7c092e34c3958871dbd01399eab", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)Hex(3)dHex(3)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 22:26:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f86bb7c092e34c3958871dbd01399eab", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:26:33 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "f86bb7c092e34c3958871dbd01399eab", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:26:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46763GM"}, "ts": "2023-07-06 22:26:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80583XN"}, "ts": "2023-07-06 22:26:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86681SC"}, "ts": "2023-07-06 22:26:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94516KE"}, "ts": "2023-07-06 22:26:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73162HV"}, "ts": "2023-07-06 22:26:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66904GT"}, "ts": "2023-07-06 22:26:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62894KT"}, "ts": "2023-07-06 22:26:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92062TF"}, "ts": "2023-07-06 22:26:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23984SE"}, "ts": "2023-07-06 22:26:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74012OU"}, "ts": "2023-07-06 22:26:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03930BU"}, "ts": "2023-07-06 22:26:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06231AO"}, "ts": "2023-07-06 22:26:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24255JV"}, "ts": "2023-07-06 22:26:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20180GO"}, "ts": "2023-07-06 22:26:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23021IW"}, "ts": "2023-07-06 22:26:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15439"}, "ts": "2023-07-06 22:26:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15439", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:26:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:27:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CF2"}, "ts": "2023-07-06 22:27:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CF2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:27:10 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "f86bb7c092e34c3958871dbd01399eab", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:27:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03895RQ"}, "ts": "2023-07-06 22:27:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24661ER"}, "ts": "2023-07-06 22:27:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20065XU"}, "ts": "2023-07-06 22:27:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07517TD"}, "ts": "2023-07-06 22:27:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64873JT"}, "ts": "2023-07-06 22:27:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22732RT"}, "ts": "2023-07-06 22:27:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79691XX"}, "ts": "2023-07-06 22:27:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75465YX"}, "ts": "2023-07-06 22:27:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54762FC"}, "ts": "2023-07-06 22:27:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97612GY"}, "ts": "2023-07-06 22:27:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29184RN"}, "ts": "2023-07-06 22:27:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46777RZ"}, "ts": "2023-07-06 22:27:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08427TM"}, "ts": "2023-07-06 22:27:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32639VU"}, "ts": "2023-07-06 22:27:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84159UV"}, "ts": "2023-07-06 22:27:27 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "f86bb7c092e34c3958871dbd01399eab", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": []}, "ts": "2023-07-06 22:27:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89019WK"}, "ts": "2023-07-06 22:27:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06161ID"}, "ts": "2023-07-06 22:27:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86407VN"}, "ts": "2023-07-06 22:27:30 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "f86bb7c092e34c3958871dbd01399eab", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:27:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f86bb7c092e34c3958871dbd01399eab", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:27:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02799CL"}, "ts": "2023-07-06 22:27:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93636BY"}, "ts": "2023-07-06 22:27:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99372JL"}, "ts": "2023-07-06 22:27:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36157LL"}, "ts": "2023-07-06 22:27:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36046VV"}, "ts": "2023-07-06 22:27:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07578MJ"}, "ts": "2023-07-06 22:27:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04536JV"}, "ts": "2023-07-06 22:27:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70631UV"}, "ts": "2023-07-06 22:27:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26827ST"}, "ts": "2023-07-06 22:27:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78992FU"}, "ts": "2023-07-06 22:27:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:27:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G23021IW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:28:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G23021IW"}, "ts": "2023-07-06 22:28:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69768VE"}, "ts": "2023-07-06 22:28:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74270QR"}, "ts": "2023-07-06 22:28:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51099WR"}, "ts": "2023-07-06 22:28:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17742", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:28:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17742.108.108"}, "ts": "2023-07-06 22:28:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57437LI"}, "ts": "2023-07-06 22:29:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57437LI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:29:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 22:29:16 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 22:29:16 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 22:29:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:29:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:29:17 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(4)Hex(3)Fuc(2)", "term_category": "any"}, "ts": "2023-07-06 22:29:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 22:29:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(4)Hex(3)Fuc(2)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 22:29:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21555369", "type": "PubMed"}, "ts": "2023-07-06 22:29:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21555369", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 22:29:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 22:29:26 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(4)Hex(3)dHex(2)", "term_category": "any"}, "ts": "2023-07-06 22:29:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">932d0b7643745adce7652721f7f84c4d", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(4)Hex(3)dHex(2)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 22:29:26 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "932d0b7643745adce7652721f7f84c4d", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:29:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "932d0b7643745adce7652721f7f84c4d", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:29:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81410HG"}, "ts": "2023-07-06 22:29:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19353SW"}, "ts": "2023-07-06 22:29:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73047IH"}, "ts": "2023-07-06 22:29:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84618NL"}, "ts": "2023-07-06 22:29:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52162PS"}, "ts": "2023-07-06 22:29:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27776PG"}, "ts": "2023-07-06 22:29:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90175OT"}, "ts": "2023-07-06 22:29:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17160IJ"}, "ts": "2023-07-06 22:29:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69912LP"}, "ts": "2023-07-06 22:29:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79643VQ"}, "ts": "2023-07-06 22:29:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47216WH"}, "ts": "2023-07-06 22:29:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86884BW"}, "ts": "2023-07-06 22:29:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84692YW"}, "ts": "2023-07-06 22:29:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27129QJ"}, "ts": "2023-07-06 22:29:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64418SR"}, "ts": "2023-07-06 22:29:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10223RO"}, "ts": "2023-07-06 22:29:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21928XN"}, "ts": "2023-07-06 22:29:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29948BS"}, "ts": "2023-07-06 22:29:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "932d0b7643745adce7652721f7f84c4d", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:29:31 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "932d0b7643745adce7652721f7f84c4d", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:29:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63193FF"}, "ts": "2023-07-06 22:29:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43925AD"}, "ts": "2023-07-06 22:29:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18853HA"}, "ts": "2023-07-06 22:29:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09424UT"}, "ts": "2023-07-06 22:29:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28040SC"}, "ts": "2023-07-06 22:29:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86085HN"}, "ts": "2023-07-06 22:29:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18878PL"}, "ts": "2023-07-06 22:29:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53880XP"}, "ts": "2023-07-06 22:29:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26228QQ"}, "ts": "2023-07-06 22:29:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80618TG"}, "ts": "2023-07-06 22:29:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95324VU"}, "ts": "2023-07-06 22:29:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G51287LK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:29:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G51287LK"}, "ts": "2023-07-06 22:29:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25612EW"}, "ts": "2023-07-06 22:29:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27724VO"}, "ts": "2023-07-06 22:29:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35898DT"}, "ts": "2023-07-06 22:29:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37381UQ"}, "ts": "2023-07-06 22:29:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53498KG"}, "ts": "2023-07-06 22:29:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54951YG"}, "ts": "2023-07-06 22:29:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54144YI"}, "ts": "2023-07-06 22:29:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60920ZG"}, "ts": "2023-07-06 22:29:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65600KO"}, "ts": "2023-07-06 22:29:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74785LO"}, "ts": "2023-07-06 22:29:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82092PV"}, "ts": "2023-07-06 22:29:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QY48", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:29:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QY48"}, "ts": "2023-07-06 22:29:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "932d0b7643745adce7652721f7f84c4d", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:30:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "932d0b7643745adce7652721f7f84c4d", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:30:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "932d0b7643745adce7652721f7f84c4d", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:30:05 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "932d0b7643745adce7652721f7f84c4d", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:30:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61855PQ"}, "ts": "2023-07-06 22:30:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61855PQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:30:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29731EF"}, "ts": "2023-07-06 22:30:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:30:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15365"}, "ts": "2023-07-06 22:30:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15365", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:30:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "932d0b7643745adce7652721f7f84c4d", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:30:17 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "932d0b7643745adce7652721f7f84c4d", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:30:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NDA2"}, "ts": "2023-07-06 22:30:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "932d0b7643745adce7652721f7f84c4d", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:30:24 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "932d0b7643745adce7652721f7f84c4d", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:30:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G08190JB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:30:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G08190JB"}, "ts": "2023-07-06 22:30:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49358BI"}, "ts": "2023-07-06 22:30:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79093TF"}, "ts": "2023-07-06 22:30:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NS15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:30:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NS15"}, "ts": "2023-07-06 22:30:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21357689", "type": "PubMed"}, "ts": "2023-07-06 22:30:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21357689", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 22:30:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q06643.89.89"}, "ts": "2023-07-06 22:31:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06643", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:31:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92560.384.384"}, "ts": "2023-07-06 22:31:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92560", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:31:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86UP6.54.54"}, "ts": "2023-07-06 22:31:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UP6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:31:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q05193.231.231"}, "ts": "2023-07-06 22:31:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05193", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:31:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A7S4-1"}, "ts": "2023-07-06 22:31:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A7S4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:31:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:31:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60763"}, "ts": "2023-07-06 22:31:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60763", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:31:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78330"}, "ts": "2023-07-06 22:31:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04003", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:32:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 22:32:16 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 22:32:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:32:17 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 22:32:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:32:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 22:32:20 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)Hex(3)NeuAc(2)", "term_category": "any"}, "ts": "2023-07-06 22:32:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">8713ef04477b4343065317298586190c", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)Hex(3)NeuAc(2)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 22:32:20 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8713ef04477b4343065317298586190c", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:32:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8713ef04477b4343065317298586190c", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:32:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54937EM"}, "ts": "2023-07-06 22:32:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25127JU"}, "ts": "2023-07-06 22:32:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30392XP"}, "ts": "2023-07-06 22:32:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00728SN"}, "ts": "2023-07-06 22:32:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17709UI"}, "ts": "2023-07-06 22:32:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07191NE"}, "ts": "2023-07-06 22:32:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68391RZ"}, "ts": "2023-07-06 22:32:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54083SI"}, "ts": "2023-07-06 22:32:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00430ZK"}, "ts": "2023-07-06 22:32:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53220ZS"}, "ts": "2023-07-06 22:32:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51586EE"}, "ts": "2023-07-06 22:32:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50896EJ"}, "ts": "2023-07-06 22:32:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10925II"}, "ts": "2023-07-06 22:32:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54264AR"}, "ts": "2023-07-06 22:32:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75786FQ"}, "ts": "2023-07-06 22:32:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H5J4.133.133"}, "ts": "2023-07-06 22:32:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H5J4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:32:25 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8713ef04477b4343065317298586190c", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:32:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8713ef04477b4343065317298586190c", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:32:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19793PI"}, "ts": "2023-07-06 22:32:27 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8713ef04477b4343065317298586190c", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:32:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54572EC"}, "ts": "2023-07-06 22:32:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88117JW"}, "ts": "2023-07-06 22:32:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02972HU"}, "ts": "2023-07-06 22:32:30 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8713ef04477b4343065317298586190c", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:32:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00980BE"}, "ts": "2023-07-06 22:32:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68210RO"}, "ts": "2023-07-06 22:32:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51100CM"}, "ts": "2023-07-06 22:32:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87847UQ"}, "ts": "2023-07-06 22:32:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55239YU"}, "ts": "2023-07-06 22:32:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52179YJ"}, "ts": "2023-07-06 22:32:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77149IZ"}, "ts": "2023-07-06 22:32:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97595JJ"}, "ts": "2023-07-06 22:32:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25064SU"}, "ts": "2023-07-06 22:32:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97956ZX"}, "ts": "2023-07-06 22:32:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71397AY"}, "ts": "2023-07-06 22:32:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67293HE"}, "ts": "2023-07-06 22:32:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25499LZ"}, "ts": "2023-07-06 22:32:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69189FV"}, "ts": "2023-07-06 22:32:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71713QS"}, "ts": "2023-07-06 22:32:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08537", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:32:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08537"}, "ts": "2023-07-06 22:32:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:32:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UM21"}, "ts": "2023-07-06 22:32:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UM21", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:32:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G51586EE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:32:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G51586EE"}, "ts": "2023-07-06 22:32:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13058MK"}, "ts": "2023-07-06 22:32:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 22:33:01 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O15455", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 22:33:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15455", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 22:33:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G75762RH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:33:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G75762RH"}, "ts": "2023-07-06 22:33:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F6VAN0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:33:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "F6VAN0.570.570"}, "ts": "2023-07-06 22:33:28 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 22:33:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:33:58 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 22:33:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:33:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 22:34:06 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)Hex(3)dHex(1)NeuAc(2)", "term_category": "any"}, "ts": "2023-07-06 22:34:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">29ec7e7606832b64adfd74d3cb6246d8", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)Hex(3)dHex(1)NeuAc(2)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 22:34:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29ec7e7606832b64adfd74d3cb6246d8", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:34:07 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "29ec7e7606832b64adfd74d3cb6246d8", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:34:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89753PC"}, "ts": "2023-07-06 22:34:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64563CQ"}, "ts": "2023-07-06 22:34:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40289VL"}, "ts": "2023-07-06 22:34:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50824HV"}, "ts": "2023-07-06 22:34:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49088AN"}, "ts": "2023-07-06 22:34:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86454PA"}, "ts": "2023-07-06 22:34:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65268SY"}, "ts": "2023-07-06 22:34:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52106VD"}, "ts": "2023-07-06 22:34:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34892QQ"}, "ts": "2023-07-06 22:34:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65537UV"}, "ts": "2023-07-06 22:34:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79265CF"}, "ts": "2023-07-06 22:34:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84515GE"}, "ts": "2023-07-06 22:34:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00944OL"}, "ts": "2023-07-06 22:34:09 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "29ec7e7606832b64adfd74d3cb6246d8", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:34:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29ec7e7606832b64adfd74d3cb6246d8", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:34:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G32652KI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:34:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G32652KI"}, "ts": "2023-07-06 22:34:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16860.70.70"}, "ts": "2023-07-06 22:34:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16860", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:34:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HDC9"}, "ts": "2023-07-06 22:34:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HDC9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:34:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26262", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:34:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26262"}, "ts": "2023-07-06 22:34:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K490-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:35:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K490-1"}, "ts": "2023-07-06 22:35:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96CH1.9.9"}, "ts": "2023-07-06 22:35:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CH1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:35:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 22:35:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:35:37 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 22:35:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:35:38 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(4)Hex(4)dHex(3)", "term_category": "any"}, "ts": "2023-07-06 22:35:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 22:35:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">1d7a9895070091b9d1350065a1c03358", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(4)Hex(4)dHex(3)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 22:35:47 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "1d7a9895070091b9d1350065a1c03358", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:35:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1d7a9895070091b9d1350065a1c03358", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:35:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00978GW"}, "ts": "2023-07-06 22:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59658KK"}, "ts": "2023-07-06 22:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77550KK"}, "ts": "2023-07-06 22:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25278BX"}, "ts": "2023-07-06 22:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47448YK"}, "ts": "2023-07-06 22:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11009FR"}, "ts": "2023-07-06 22:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21672MV"}, "ts": "2023-07-06 22:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69774ND"}, "ts": "2023-07-06 22:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98073MH"}, "ts": "2023-07-06 22:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16739XD"}, "ts": "2023-07-06 22:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60615ZD"}, "ts": "2023-07-06 22:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55638XL"}, "ts": "2023-07-06 22:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23463KX"}, "ts": "2023-07-06 22:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14346JI"}, "ts": "2023-07-06 22:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59810YR"}, "ts": "2023-07-06 22:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97650EC"}, "ts": "2023-07-06 22:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28136FA"}, "ts": "2023-07-06 22:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03462LS"}, "ts": "2023-07-06 22:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73440TD"}, "ts": "2023-07-06 22:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24475OY"}, "ts": "2023-07-06 22:35:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1d7a9895070091b9d1350065a1c03358", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:35:52 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "1d7a9895070091b9d1350065a1c03358", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:35:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76505ZE"}, "ts": "2023-07-06 22:35:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74012IM"}, "ts": "2023-07-06 22:35:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08308ZP"}, "ts": "2023-07-06 22:35:53 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "1d7a9895070091b9d1350065a1c03358", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:35:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95203RC"}, "ts": "2023-07-06 22:35:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95495MU"}, "ts": "2023-07-06 22:35:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09781FH"}, "ts": "2023-07-06 22:35:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14966"}, "ts": "2023-07-06 22:35:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18995MT"}, "ts": "2023-07-06 22:35:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48941WE"}, "ts": "2023-07-06 22:35:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53426PR"}, "ts": "2023-07-06 22:35:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64236WJ"}, "ts": "2023-07-06 22:35:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47868BO"}, "ts": "2023-07-06 22:35:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99770FX"}, "ts": "2023-07-06 22:35:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14966", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:36:00 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "1d7a9895070091b9d1350065a1c03358", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:36:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67147CZ"}, "ts": "2023-07-06 22:36:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46029TT"}, "ts": "2023-07-06 22:36:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75851ZW"}, "ts": "2023-07-06 22:36:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25935VE"}, "ts": "2023-07-06 22:36:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68637SE"}, "ts": "2023-07-06 22:36:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03140AX"}, "ts": "2023-07-06 22:36:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55282VK"}, "ts": "2023-07-06 22:36:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24120OI"}, "ts": "2023-07-06 22:36:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08382XT"}, "ts": "2023-07-06 22:36:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35644NQ"}, "ts": "2023-07-06 22:36:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84862VB"}, "ts": "2023-07-06 22:36:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95448VV"}, "ts": "2023-07-06 22:36:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08224KD"}, "ts": "2023-07-06 22:36:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79083TY"}, "ts": "2023-07-06 22:36:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66166BF"}, "ts": "2023-07-06 22:36:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45402WV"}, "ts": "2023-07-06 22:36:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19487573", "type": "PubMed"}, "ts": "2023-07-06 22:36:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19487573", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 22:36:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G47448YK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:36:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G47448YK"}, "ts": "2023-07-06 22:36:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 22:37:45 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 22:37:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:37:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WUM4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:37:45 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 22:37:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:37:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WUM4"}, "ts": "2023-07-06 22:37:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96DY7"}, "ts": "2023-07-06 22:37:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96DY7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:37:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 22:37:58 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)Hex(3)dHex(2)NeuAc(2)", "term_category": "any"}, "ts": "2023-07-06 22:37:58 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00033MO"}, "ts": "2023-07-06 22:37:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">3604529d64a16e169098faea9268d8ff", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)Hex(3)dHex(2)NeuAc(2)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 22:37:58 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3604529d64a16e169098faea9268d8ff", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:37:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3604529d64a16e169098faea9268d8ff", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:37:59 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3604529d64a16e169098faea9268d8ff", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:38:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3604529d64a16e169098faea9268d8ff", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:38:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G95151JF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:38:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G95151JF"}, "ts": "2023-07-06 22:38:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000024"}, "ts": "2023-07-06 22:38:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70492BH"}, "ts": "2023-07-06 22:38:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K3Z0-1"}, "ts": "2023-07-06 22:39:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K3Z0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:39:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49194", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 22:39:45 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P49194", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 22:39:46 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 22:39:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 22:39:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:39:53 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 22:39:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:39:54 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(4)Hex(4)dHex(2)NeuAc(1)", "term_category": "any"}, "ts": "2023-07-06 22:40:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 22:40:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">5f2b8c83cfd1bc254e456b7c216f9f4f", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(4)Hex(4)dHex(2)NeuAc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 22:40:06 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "5f2b8c83cfd1bc254e456b7c216f9f4f", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:40:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "5f2b8c83cfd1bc254e456b7c216f9f4f", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:40:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75097UM"}, "ts": "2023-07-06 22:40:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78173WX"}, "ts": "2023-07-06 22:40:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97842ZO"}, "ts": "2023-07-06 22:40:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57320FY"}, "ts": "2023-07-06 22:40:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80673NC"}, "ts": "2023-07-06 22:40:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21241VN"}, "ts": "2023-07-06 22:40:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55413YQ"}, "ts": "2023-07-06 22:40:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97067GW"}, "ts": "2023-07-06 22:40:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41957CI"}, "ts": "2023-07-06 22:40:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04702UE"}, "ts": "2023-07-06 22:40:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55773UK"}, "ts": "2023-07-06 22:40:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P43628.41.41"}, "ts": "2023-07-06 22:40:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43628", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:40:20 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G79342RE"}, "ts": "2023-07-06 22:40:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G79342RE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:40:25 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "5f2b8c83cfd1bc254e456b7c216f9f4f", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:40:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "5f2b8c83cfd1bc254e456b7c216f9f4f", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:40:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52236QQ"}, "ts": "2023-07-06 22:40:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02460JI"}, "ts": "2023-07-06 22:40:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87185IP"}, "ts": "2023-07-06 22:40:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G46524LG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:40:36 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G46524LG"}, "ts": "2023-07-06 22:40:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96356PZ"}, "ts": "2023-07-06 22:40:38 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "5f2b8c83cfd1bc254e456b7c216f9f4f", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:40:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "5f2b8c83cfd1bc254e456b7c216f9f4f", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:40:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "5f2b8c83cfd1bc254e456b7c216f9f4f", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:40:43 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "5f2b8c83cfd1bc254e456b7c216f9f4f", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-06 22:40:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G13863XN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:40:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G13863XN"}, "ts": "2023-07-06 22:40:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G73430PD"}, "ts": "2023-07-06 22:41:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G73430PD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:41:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:41:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96P11-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:41:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96P11-1"}, "ts": "2023-07-06 22:41:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 22:42:06 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 22:42:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:42:07 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-06 22:42:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-06 22:42:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G48414YA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:42:14 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(4)Hex(4)dHex(3)NeuAc(1)", "term_category": "any"}, "ts": "2023-07-06 22:42:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-06 22:42:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">fd695688767fcfde037acc2821046751", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(4)Hex(4)dHex(3)NeuAc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-06 22:42:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "fd695688767fcfde037acc2821046751", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-06 22:42:16 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "fd695688767fcfde037acc2821046751", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-06 22:42:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52457VS"}, "ts": "2023-07-06 22:42:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22166AH"}, "ts": "2023-07-06 22:42:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G25278BX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:42:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G25278BX"}, "ts": "2023-07-06 22:42:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95174IW"}, "ts": "2023-07-06 22:42:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26200341", "type": "PubMed"}, "ts": "2023-07-06 22:42:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26200341", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 22:42:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N808.45.45"}, "ts": "2023-07-06 22:43:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N808", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:43:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14659", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 22:43:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14659"}, "ts": "2023-07-06 22:43:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08133.537.537"}, "ts": "2023-07-06 22:43:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08133", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:43:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQ07-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:43:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TQ07-1"}, "ts": "2023-07-06 22:43:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPQ0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:44:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UPQ0.216.216"}, "ts": "2023-07-06 22:44:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:44:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJF2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:44:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJF2"}, "ts": "2023-07-06 22:44:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3KR73-1"}, "ts": "2023-07-06 22:44:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3KR73-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:44:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6QI36-1"}, "ts": "2023-07-06 22:44:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6QI36-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:44:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61966"}, "ts": "2023-07-06 22:45:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61966", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:45:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5S8"}, "ts": "2023-07-06 22:45:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60502"}, "ts": "2023-07-06 22:45:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5S8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:45:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G09744CN"}, "ts": "2023-07-06 22:45:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G09744CN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:45:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R4C9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:45:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R4C9-1"}, "ts": "2023-07-06 22:45:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A087WSZ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:45:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A087WSZ9"}, "ts": "2023-07-06 22:45:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TB30", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:45:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5TB30"}, "ts": "2023-07-06 22:45:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5H0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:45:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5H0.49.49"}, "ts": "2023-07-06 22:45:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15021", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:46:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15021.71.71"}, "ts": "2023-07-06 22:46:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16104"}, "ts": "2023-07-06 22:46:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16104", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:46:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15229", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:46:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15229"}, "ts": "2023-07-06 22:46:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TEC5.717.717"}, "ts": "2023-07-06 22:46:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TEC5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:46:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZKJ8-1"}, "ts": "2023-07-06 22:46:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZKJ8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:46:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08476.308.308"}, "ts": "2023-07-06 22:46:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08476", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:46:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZPX4"}, "ts": "2023-07-06 22:46:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZPX4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:46:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15751", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 22:47:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15751"}, "ts": "2023-07-06 22:47:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G39344CL"}, "ts": "2023-07-06 22:47:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G39344CL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:47:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:47:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05543", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:47:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05543.253.253"}, "ts": "2023-07-06 22:47:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84820NF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:48:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84820NF"}, "ts": "2023-07-06 22:48:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ESR9-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 22:48:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ESR9-1"}, "ts": "2023-07-06 22:48:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75475", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:49:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75475"}, "ts": "2023-07-06 22:49:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92932", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:49:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92932"}, "ts": "2023-07-06 22:49:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04217-1"}, "ts": "2023-07-06 22:50:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04217-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:50:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05186", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:50:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05186"}, "ts": "2023-07-06 22:50:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30193849", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 22:51:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30193849", "type": "PubMed"}, "ts": "2023-07-06 22:51:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62314", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:51:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62314"}, "ts": "2023-07-06 22:51:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16870"}, "ts": "2023-07-06 22:51:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16870", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:51:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61559", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:52:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61559"}, "ts": "2023-07-06 22:52:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PZ7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:53:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96PZ7.1644.1644"}, "ts": "2023-07-06 22:53:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q2WGJ8.56.56"}, "ts": "2023-07-06 22:54:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2WGJ8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:54:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z865", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 22:54:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z865"}, "ts": "2023-07-06 22:54:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35409"}, "ts": "2023-07-06 22:54:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35409", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:54:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G94923PG"}, "ts": "2023-07-06 22:55:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G94923PG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 22:55:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZAT1-1"}, "ts": "2023-07-06 22:55:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZAT1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:55:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K5B2-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 22:55:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K5B2-1"}, "ts": "2023-07-06 22:55:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A1L0-1"}, "ts": "2023-07-06 22:55:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A1L0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:55:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01185", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:55:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01185"}, "ts": "2023-07-06 22:55:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R4D5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:56:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R4D5-1"}, "ts": "2023-07-06 22:56:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EQ87-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:56:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EQ87-1"}, "ts": "2023-07-06 22:56:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0B4J2D5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:56:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0B4J2D5"}, "ts": "2023-07-06 22:56:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RB34-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:56:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RB34-1"}, "ts": "2023-07-06 22:56:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95154-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:56:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95154-1"}, "ts": "2023-07-06 22:56:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 22:56:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLY8", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 22:56:51 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9JLY8", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 22:56:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLY8", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 22:56:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06737"}, "ts": "2023-07-06 22:56:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KM62-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 22:56:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KM62-1"}, "ts": "2023-07-06 22:56:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9497261", "type": "PubMed"}, "ts": "2023-07-06 22:58:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9497261", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 22:58:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99102.624.624"}, "ts": "2023-07-06 22:59:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99102", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 22:59:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00629"}, "ts": "2023-07-06 22:59:22 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-06 23:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-06 23:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-06 23:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-06 23:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-06 23:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-06 23:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63302", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 23:00:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63302"}, "ts": "2023-07-06 23:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G04286YE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 23:00:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G04286YE"}, "ts": "2023-07-06 23:00:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B0BND5"}, "ts": "2023-07-06 23:00:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B0BND5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:00:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A8MXV4"}, "ts": "2023-07-06 23:00:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8MXV4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:01:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4LDG9"}, "ts": "2023-07-06 23:01:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4LDG9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:01:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXK1"}, "ts": "2023-07-06 23:01:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXK1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:01:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60502", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:01:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86VI3"}, "ts": "2023-07-06 23:01:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86VI3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:01:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CQR4"}, "ts": "2023-07-06 23:01:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CQR4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 23:01:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P179", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:01:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P179"}, "ts": "2023-07-06 23:01:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12111-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:02:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P12111-1.2079.2079"}, "ts": "2023-07-06 23:02:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28067909", "type": "PubMed"}, "ts": "2023-07-06 23:02:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28067909", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:02:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04900"}, "ts": "2023-07-06 23:02:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04900", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:02:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:02:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52756", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:02:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52756"}, "ts": "2023-07-06 23:02:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10773YW"}, "ts": "2023-07-06 23:02:58 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G04410LH"}, "ts": "2023-07-06 23:03:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G04410LH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 23:03:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q50LG9"}, "ts": "2023-07-06 23:03:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q50LG9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:03:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08879", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:03:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08879"}, "ts": "2023-07-06 23:03:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92478", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:03:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92478"}, "ts": "2023-07-06 23:03:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56354PO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 23:03:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56354PO"}, "ts": "2023-07-06 23:03:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZR52-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:04:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZR52-1"}, "ts": "2023-07-06 23:04:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 23:05:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G98066UT"}, "ts": "2023-07-06 23:05:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G98066UT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 23:05:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:05:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60381", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:05:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60381"}, "ts": "2023-07-06 23:05:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50219"}, "ts": "2023-07-06 23:05:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50219", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:06:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R044", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 23:06:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R044"}, "ts": "2023-07-06 23:06:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BKE6"}, "ts": "2023-07-06 23:06:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BKE6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:06:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLF7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:06:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06694XM"}, "ts": "2023-07-06 23:07:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06694XM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 23:07:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RYG4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:07:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RYG4-1"}, "ts": "2023-07-06 23:07:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64061QG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 23:07:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64061QG"}, "ts": "2023-07-06 23:07:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52789"}, "ts": "2023-07-06 23:08:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:08:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RBT5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 23:08:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RBT5"}, "ts": "2023-07-06 23:08:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-06 23:09:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11215.734.734"}, "ts": "2023-07-06 23:10:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11215", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:10:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12655004", "type": "PubMed"}, "ts": "2023-07-06 23:10:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12655004", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:10:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RAV0-1"}, "ts": "2023-07-06 23:10:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RAV0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:10:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14896"}, "ts": "2023-07-06 23:10:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14896", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:10:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P30086.6.6"}, "ts": "2023-07-06 23:10:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30086", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:10:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00338"}, "ts": "2023-07-06 23:10:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZ83", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:11:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IZ83"}, "ts": "2023-07-06 23:11:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WVL9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:12:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WVL9"}, "ts": "2023-07-06 23:12:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4AA65", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:12:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4AA65"}, "ts": "2023-07-06 23:12:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IU57", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:12:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IU57"}, "ts": "2023-07-06 23:12:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3L8U1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 23:12:50 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q3L8U1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 23:12:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NY74.716.716"}, "ts": "2023-07-06 23:12:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NY74", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:12:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K2P2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:13:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K2P2-1"}, "ts": "2023-07-06 23:13:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99836", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:13:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99836"}, "ts": "2023-07-06 23:13:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15321", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:13:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15321"}, "ts": "2023-07-06 23:13:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01587.92.92"}, "ts": "2023-07-06 23:13:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01587", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:13:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UIA9.674.674"}, "ts": "2023-07-06 23:14:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UIA9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:14:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UGM1-1"}, "ts": "2023-07-06 23:14:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGM1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:14:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54840"}, "ts": "2023-07-06 23:14:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54840", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:14:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55157"}, "ts": "2023-07-06 23:14:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3YVF0"}, "ts": "2023-07-06 23:15:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3YVF0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:15:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NET4"}, "ts": "2023-07-06 23:15:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00629", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:15:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NET4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:15:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22717650", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:15:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22717650", "type": "PubMed"}, "ts": "2023-07-06 23:15:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:15:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QZ15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:15:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QZ15"}, "ts": "2023-07-06 23:15:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27555321", "type": "PubMed"}, "ts": "2023-07-06 23:16:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27555321", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:16:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G63825EI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 23:16:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G63825EI"}, "ts": "2023-07-06 23:16:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R4G3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:16:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R4G3"}, "ts": "2023-07-06 23:16:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "25556311"}, "ts": "2023-07-06 23:16:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:16:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 23:16:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 23:16:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U2S6"}, "ts": "2023-07-06 23:16:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U2S6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 23:16:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12872.921.921"}, "ts": "2023-07-06 23:18:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G10773YW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 23:18:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:19:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21695211", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:19:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21695211", "type": "PubMed"}, "ts": "2023-07-06 23:19:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14151-1"}, "ts": "2023-07-06 23:19:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12037567", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:20:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12037567", "type": "PubMed"}, "ts": "2023-07-06 23:20:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G60919EU"}, "ts": "2023-07-06 23:20:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60919EU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 23:20:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 23:20:42 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-06 23:20:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-06 23:20:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34320850", "type": "PubMed"}, "ts": "2023-07-06 23:20:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34320850", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:20:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:21:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZTP0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:21:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZTP0-1"}, "ts": "2023-07-06 23:21:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P38571"}, "ts": "2023-07-06 23:21:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38571", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:21:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00013", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:21:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q00013.7.7"}, "ts": "2023-07-06 23:21:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A0Q3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:21:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A0Q3"}, "ts": "2023-07-06 23:21:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22129529", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:22:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22129529", "type": "PubMed"}, "ts": "2023-07-06 23:22:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DCR4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 23:22:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DCR4"}, "ts": "2023-07-06 23:22:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2K3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:22:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P2K3"}, "ts": "2023-07-06 23:22:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HCJ0"}, "ts": "2023-07-06 23:23:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCJ0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:23:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86SE5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:23:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86SE5"}, "ts": "2023-07-06 23:23:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:23:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BU76", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:23:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BU76.219.219"}, "ts": "2023-07-06 23:23:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R4P6-1"}, "ts": "2023-07-06 23:23:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R4P6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:23:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10425SO"}, "ts": "2023-07-06 23:23:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52789", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:23:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BX74.197.197"}, "ts": "2023-07-06 23:24:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BX74", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:24:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:24:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19404-1"}, "ts": "2023-07-06 23:24:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19404-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:24:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "L7N1Z9-1"}, "ts": "2023-07-06 23:24:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K1X3-1"}, "ts": "2023-07-06 23:24:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K1X3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:24:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "L7N1Z9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:24:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22005"}, "ts": "2023-07-06 23:24:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22005", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:24:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N149.289.289"}, "ts": "2023-07-06 23:24:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N149", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:24:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17346786", "type": "PubMed"}, "ts": "2023-07-06 23:24:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17346786", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:24:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 23:24:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G59062KT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 23:24:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G59062KT"}, "ts": "2023-07-06 23:24:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G71013KY"}, "ts": "2023-07-06 23:25:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RZ44-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:25:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RZ44-1"}, "ts": "2023-07-06 23:25:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:25:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05067.757.757"}, "ts": "2023-07-06 23:25:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05067", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:25:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00912UN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 23:25:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZPS4-1"}, "ts": "2023-07-06 23:25:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZPS4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:25:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q920P3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:26:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q920P3-1"}, "ts": "2023-07-06 23:26:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z173", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:26:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z173"}, "ts": "2023-07-06 23:26:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00338", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:26:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RD63-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:28:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RD63-1"}, "ts": "2023-07-06 23:28:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y219", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:28:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y219.764.764"}, "ts": "2023-07-06 23:28:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54819"}, "ts": "2023-07-06 23:28:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54819", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:28:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49902", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:28:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49902"}, "ts": "2023-07-06 23:28:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35668", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 23:28:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23664977", "type": "PubMed"}, "ts": "2023-07-06 23:28:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35668"}, "ts": "2023-07-06 23:28:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23664977", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:28:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QY44", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:28:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QY44"}, "ts": "2023-07-06 23:28:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55290", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:28:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55290.638.638"}, "ts": "2023-07-06 23:28:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55268", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:29:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55268.911.911"}, "ts": "2023-07-06 23:29:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03405"}, "ts": "2023-07-06 23:30:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03405", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:30:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13421", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 23:30:23 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q13421", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 23:30:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18348712", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:30:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18348712", "type": "PubMed"}, "ts": "2023-07-06 23:30:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BQ61", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:31:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BQ61"}, "ts": "2023-07-06 23:31:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4X5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:31:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y4X5.409.409"}, "ts": "2023-07-06 23:31:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G71817IG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 23:31:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G71817IG"}, "ts": "2023-07-06 23:31:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96LC7"}, "ts": "2023-07-06 23:31:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96LC7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:31:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G79023HL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 23:31:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G79023HL"}, "ts": "2023-07-06 23:31:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXH1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:32:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UXH1"}, "ts": "2023-07-06 23:32:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G40724HZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 23:32:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G40724HZ"}, "ts": "2023-07-06 23:32:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61406KC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 23:32:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61406KC"}, "ts": "2023-07-06 23:32:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00548.40.40"}, "ts": "2023-07-06 23:33:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00548", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:33:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IY21", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 23:33:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IY21"}, "ts": "2023-07-06 23:33:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D9S2"}, "ts": "2023-07-06 23:34:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D9S2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 23:34:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06576"}, "ts": "2023-07-06 23:34:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1518849", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:35:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1518849", "type": "PubMed"}, "ts": "2023-07-06 23:35:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:35:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:35:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z0M6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:35:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z0M6"}, "ts": "2023-07-06 23:35:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08859", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:35:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08859"}, "ts": "2023-07-06 23:35:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96EP1-1"}, "ts": "2023-07-06 23:35:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12036"}, "ts": "2023-07-06 23:35:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12036", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:35:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96EP1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:35:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14151-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:35:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16257123", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:35:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16257123", "type": "PubMed"}, "ts": "2023-07-06 23:35:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A4UGR9"}, "ts": "2023-07-06 23:35:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A4UGR9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:35:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2479380", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:35:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2479380", "type": "PubMed"}, "ts": "2023-07-06 23:35:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14571", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:35:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14571"}, "ts": "2023-07-06 23:35:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12259"}, "ts": "2023-07-06 23:36:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LMQ4-1"}, "ts": "2023-07-06 23:36:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LMQ4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:36:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGT4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:36:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UGT4.101.101"}, "ts": "2023-07-06 23:36:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21730"}, "ts": "2023-07-06 23:36:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NSI6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:36:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NSI6"}, "ts": "2023-07-06 23:36:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21730", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:36:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A7D6-1"}, "ts": "2023-07-06 23:36:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A7D6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:37:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RBN7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:37:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RBN7-1"}, "ts": "2023-07-06 23:37:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8530046", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:37:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8530046", "type": "PubMed"}, "ts": "2023-07-06 23:37:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:37:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11167"}, "ts": "2023-07-06 23:37:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11167", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:37:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFL0"}, "ts": "2023-07-06 23:37:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01242", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:37:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01242.132.132"}, "ts": "2023-07-06 23:37:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q29RF7.762.762"}, "ts": "2023-07-06 23:38:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q29RF7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:38:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2K5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:38:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2K5.345.345"}, "ts": "2023-07-06 23:38:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14210.476.476"}, "ts": "2023-07-06 23:38:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:38:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08571-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:38:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08571-1.151.151"}, "ts": "2023-07-06 23:38:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80TG9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:38:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80TG9"}, "ts": "2023-07-06 23:38:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K1A8-1"}, "ts": "2023-07-06 23:39:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K1A8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:39:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35410", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:39:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35410.57.57"}, "ts": "2023-07-06 23:39:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C869"}, "ts": "2023-07-06 23:39:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C869", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:39:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UNW1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:39:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UNW1"}, "ts": "2023-07-06 23:39:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZF7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 23:39:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IZF7"}, "ts": "2023-07-06 23:39:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G10425SO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 23:39:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P3A9"}, "ts": "2023-07-06 23:39:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P3A9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 23:39:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BX93", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 23:40:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BX93"}, "ts": "2023-07-06 23:40:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02689"}, "ts": "2023-07-06 23:40:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02689", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 23:40:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJX0"}, "ts": "2023-07-06 23:40:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJX0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:40:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96LU5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:41:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96LU5.92.92"}, "ts": "2023-07-06 23:41:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38432", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:42:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P38432"}, "ts": "2023-07-06 23:42:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZ08", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:42:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZ08"}, "ts": "2023-07-06 23:42:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y4L1.778.778"}, "ts": "2023-07-06 23:43:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4L1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:43:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22231912", "type": "PubMed"}, "ts": "2023-07-06 23:43:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22231912", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:43:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969F8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:43:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969F8"}, "ts": "2023-07-06 23:43:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15731106", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:43:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15731106", "type": "PubMed"}, "ts": "2023-07-06 23:43:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G94374LH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 23:43:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G94374LH"}, "ts": "2023-07-06 23:43:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:44:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RP8"}, "ts": "2023-07-06 23:44:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RP8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:44:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16656"}, "ts": "2023-07-06 23:44:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "J3QN14-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:44:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "J3QN14-1"}, "ts": "2023-07-06 23:44:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N8M0"}, "ts": "2023-07-06 23:44:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N8M0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 23:44:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WUA4"}, "ts": "2023-07-06 23:45:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WUA4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:45:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08629.53.53"}, "ts": "2023-07-06 23:45:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08629", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:45:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33357447", "type": "PubMed"}, "ts": "2023-07-06 23:45:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33357447", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:45:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20816"}, "ts": "2023-07-06 23:45:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20816", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:45:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6R7"}, "ts": "2023-07-06 23:45:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6R7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:45:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15942"}, "ts": "2023-07-06 23:46:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64124", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:46:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64124"}, "ts": "2023-07-06 23:46:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14532270", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:46:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14532270", "type": "PubMed"}, "ts": "2023-07-06 23:46:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99607", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 23:46:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99607"}, "ts": "2023-07-06 23:46:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NDB2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:47:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NDB2"}, "ts": "2023-07-06 23:47:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04150"}, "ts": "2023-07-06 23:47:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04150", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:47:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M7K9-1"}, "ts": "2023-07-06 23:47:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M7K9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:47:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16751257", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:47:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16751257", "type": "PubMed"}, "ts": "2023-07-06 23:47:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BTY1"}, "ts": "2023-07-06 23:47:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BTY1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 23:47:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:48:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L42", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:48:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96L42"}, "ts": "2023-07-06 23:48:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D659"}, "ts": "2023-07-06 23:48:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D659", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:48:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58607HL"}, "ts": "2023-07-06 23:48:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G58607HL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 23:48:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46821"}, "ts": "2023-07-06 23:48:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46821", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:48:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31821173", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:48:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31821173", "type": "PubMed"}, "ts": "2023-07-06 23:48:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C9X1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 23:48:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C9X1"}, "ts": "2023-07-06 23:48:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31821173", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-06 23:48:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12879"}, "ts": "2023-07-06 23:49:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12879", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:49:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14091", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:49:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14091"}, "ts": "2023-07-06 23:49:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95813", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:50:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95813"}, "ts": "2023-07-06 23:50:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61978"}, "ts": "2023-07-06 23:50:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61978", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:50:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V8C5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:50:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V8C5-1"}, "ts": "2023-07-06 23:50:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "31645732"}, "ts": "2023-07-06 23:50:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15599.108.108"}, "ts": "2023-07-06 23:50:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15599", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:50:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06576", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:50:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15383320", "type": "PubMed"}, "ts": "2023-07-06 23:50:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15383320", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:50:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G91625IP"}, "ts": "2023-07-06 23:51:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G91625IP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 23:51:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96AX9.508.508"}, "ts": "2023-07-06 23:51:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AX9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:51:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06746-1"}, "ts": "2023-07-06 23:52:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06746-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:52:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:52:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H6B4.365.365"}, "ts": "2023-07-06 23:52:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H6B4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:52:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NAC3"}, "ts": "2023-07-06 23:52:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NAC3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:52:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25365219", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-06 23:53:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25365219", "type": "PubMed"}, "ts": "2023-07-06 23:53:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:53:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14905"}, "ts": "2023-07-06 23:53:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14905", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:53:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2Y9-1"}, "ts": "2023-07-06 23:53:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2Y9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:53:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95861"}, "ts": "2023-07-06 23:54:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95861", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:54:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TNZ5-1"}, "ts": "2023-07-06 23:54:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TNZ5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:54:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09022-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-06 23:54:14 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P09022-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-06 23:54:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6DFV3-1"}, "ts": "2023-07-06 23:54:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6DFV3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:54:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYV4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:54:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NYV4.597.597"}, "ts": "2023-07-06 23:54:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95972", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:54:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95972"}, "ts": "2023-07-06 23:54:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P273-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 23:55:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P273-1"}, "ts": "2023-07-06 23:55:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q01955.1252.1252"}, "ts": "2023-07-06 23:55:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01955", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:55:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R5M4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 23:55:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R5M4"}, "ts": "2023-07-06 23:55:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43157", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 23:55:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43157"}, "ts": "2023-07-06 23:55:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54855-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:55:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54855-1"}, "ts": "2023-07-06 23:55:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8INK6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:56:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8INK6"}, "ts": "2023-07-06 23:56:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70513-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:56:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70513-1"}, "ts": "2023-07-06 23:56:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G19789TE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-06 23:56:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G19789TE"}, "ts": "2023-07-06 23:56:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TE77", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:56:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TE77.9.9"}, "ts": "2023-07-06 23:56:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13444"}, "ts": "2023-07-06 23:57:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13444", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:57:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96SL4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:57:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96SL4"}, "ts": "2023-07-06 23:57:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q925I1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-06 23:58:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q925I1"}, "ts": "2023-07-06 23:58:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86SQ4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-06 23:58:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86SQ4.36.36"}, "ts": "2023-07-06 23:58:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96JP2"}, "ts": "2023-07-06 23:58:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JP2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-06 23:58:44 EDT-0400"}]